(data stored in ACNUC7421 zone)

EMBL: CP001791.PE325

CP001791.PE325       Location/Qualifiers
FT   CDS_pept        350181..351032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0337"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: xfm:Xfasm12_1605 ABC
FT                   transporter sugar permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97877"
FT                   /db_xref="GOA:D6XWN5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97877.1"
FT                   /translation="MMKQKNRNDKLISISLFVFFTIVAIVALFPVASLVVAAFSPASDL
FT                   MRFGLTAELFFSAWDFTNMNAIFSGEGGNYWQWYLNSLIISGGLIIVSLFFSSMVGYAL
FT                   ALYEFKGQRFVFVLVLLIVMIPFEILMLPLFRLMTSLQLVDTYIAVMLPLIVAPIAVFF
FT                   FRQYAIGLPKELMESARVDGCTEYGIFFKIMAPLMLPSFAAMAILQGLTSWNNFLWPLL
FT                   VLRSNDMFTLPVGLATLLTPYGNNYEVLFSGAVLSIIPIIILFLFFQKFFIAGLTSGGV
FT                   KG"
     atgatgaaac aaaaaaacag aaacgacaaa ctgatttcaa tttcactgtt cgtattcttt        60
     acgatcgtgg cgatcgtggc tttgttcccg gtggcgtcac tcgtcgtagc cgcattcagc       120
     ccggcttccg acttaatgcg ttttggattg acggctgaac tgttcttttc cgcttgggat       180
     ttcacgaaca tgaatgccat tttcagtgga gaaggcggga actattggca atggtatctg       240
     aacagcctga tcatttcggg tggtttgatt atcgtttcat tgttcttctc atccatggtc       300
     gggtatgccc tggctctcta tgagtttaaa ggtcagcgtt tcgtattcgt actcgtgctt       360
     ctcattgtca tgattccttt tgagattctg atgctgccat tgttcagact tatgacgtct       420
     ttacagttgg ttgacacgta tattgcagtc atgttgccct taatcgttgc gccgattgca       480
     gttttctttt tcaggcagta tgcaattggg cttccgaaag aattaatgga atcggcacgg       540
     gtggacggct gtaccgaata cgggatcttt ttcaagatca tggccccttt aatgctgccg       600
     tcttttgcgg cgatggcgat cttgcagggc ctgacaagct ggaataactt tctctggcca       660
     ctgcttgttt tacgatctaa cgatatgttt acgttgccgg tggggctcgc aacgcttttg       720
     actccatatg ggaataacta tgaagtcctg ttttccggag ctgtactcag tattatcccg       780
     attatcatac tgttcttgtt tttccagaaa ttctttattg ccggtctgac ttcaggtggt       840
     gtaaaaggct ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page