(data stored in ACNUC7421 zone)

EMBL: CP001791.PE326

CP001791.PE326       Location/Qualifiers
FT   CDS_pept        351064..351729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0338"
FT                   /product="protein of unknown function DUF624"
FT                   /note="PFAM: protein of unknown function DUF624; KEGG:
FT                   GPT1; GABA/polyamine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97878"
FT                   /db_xref="GOA:D6XWN6"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN6"
FT                   /inference="protein motif:PFAM:PF04854"
FT                   /protein_id="ADH97878.1"
FT                   /translation="MTVKLDAFFRLITRFSLLNVNWIAGIVAGLLVLGLFPATVATFII
FT                   TRRWIREGESFSVTKAYWQAYKQVFVKANLFGIGLSAIGLLLYVNYRVIQTGGIEIPLV
FT                   VTVSFITIVFLYLLFAAAVIPVSIHFTGTPLKLIQKTIWFIFAKPHLAVLLVLLMWGIA
FT                   HVSLLVPAAILFFTGSVGAYTVMWIFLSSLDKISGIEEVQSETDQPETLSLSNRRILT"
     atgactgtga aactcgatgc attttttcgg ttaattacgc gattctcgtt gttgaatgta        60
     aattggattg caggcatcgt tgcaggtttg ttagttctcg gtcttttccc agccacggta       120
     gcgacgttca tcattaccag gcgctggatt cgggaaggtg agtctttttc ggttacgaaa       180
     gcctattggc aagcctacaa acaggttttc gtgaaagcga acttgtttgg cattgggctg       240
     agtgcaattg gactcttatt gtatgtcaat tacagggtga ttcagacagg ggggatcgag       300
     attcctctcg tcgtcaccgt cagtttcatc accatcgtat ttctgtattt gctgtttgct       360
     gcggcggtta taccggtgag tattcatttt acaggcacac cacttaaact gattcaaaag       420
     acaatctggt tcatctttgc caaaccccat cttgcggtgc ttcttgtgct tcttatgtgg       480
     gggatcgcac acgtttccct gctcgtgccg gccgccattc ttttctttac agggagtgtc       540
     ggtgcgtaca ccgttatgtg gattttcctt tcttcattgg ataaaatcag cggaattgaa       600
     gaagtacaaa gtgaaactga tcaacccgaa actctatccc tatcaaacag gaggattttg       660
     acatga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page