(data stored in ACNUC7421 zone)

EMBL: CP001791.PE327

CP001791.PE327       Location/Qualifiers
FT   CDS_pept        351726..353234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0339"
FT                   /product="alpha-L-arabinofuranosidase domain protein"
FT                   /note="PFAM: alpha-L-arabinofuranosidase domain protein;
FT                   KEGG: rlt:Rleg2_5890 alpha-N-arabinofuranosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97879"
FT                   /db_xref="GOA:D6XWN7"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWN7"
FT                   /inference="protein motif:PFAM:PF06964"
FT                   /protein_id="ADH97879.1"
FT                   /translation="MTKAKMIVDKSYKIADIDERIYGSFIEHLGRAVYGGIFEPDHPDA
FT                   DEDGFRKDVLELVKELQVPIVRYPGGNMVSAYNWEDGIGPREDRPKRLELAWRVIETNA
FT                   FGTNEFADWAKKANSEVMMAINLGTRGIDAARNFIEYTNHPGGTYWSDLRRKHGYEEPH
FT                   KIKTWCLGNEMDGPWQVGQKTAYEYGRLASEAGKAMRLVDPDIELVSCGSSHTQMPTFP
FT                   DWEAETLTHTYDVADYVSLHQYFGNRDNDSQNYLANGMELEHFISTVISVADYIKAKKR
FT                   SKKTLMLSFDEWNVWYHSNDADKEIEPWTVALPQLEDHYNFEDALLVGSILITFLKHAD
FT                   RVKMACMAQLVNVIAPIMTDNLGASWKQTIFYPYMHASVFGRGVSLKPVVNSPKFDTKD
FT                   FTDVDYLDTAVVFNEENEELTVFALNRHIKEDLVMEAQLGDFEGYRIQEHIVLEHDDLK
FT                   AVNTATNHPVKPYRNGDAVYKDGVIETKLKKASWNVIRLKLINE"
     atgacaaaag ctaaaatgat tgttgataag tcgtacaaga ttgcagatat tgatgaacgg        60
     atatacggtt cattcattga acatttgggc cgtgctgttt atggcggtat atttgagccg       120
     gatcatccgg acgcagatga agacggattt cgaaaagatg tccttgaatt ggttaaggaa       180
     ctgcaagtgc cgattgtccg ctatccgggt ggtaatatgg tgtctgccta taattgggaa       240
     gacgggattg ggccgagaga agatcgtcca aagagactcg agcttgcttg gcgtgtgatc       300
     gaaacaaacg catttggaac caatgagttt gcggattggg cgaaaaaagc caattcagaa       360
     gtcatgatgg caatcaatct tggaacccgt gggattgatg cagcgagaaa cttcattgaa       420
     tataccaatc atccgggtgg cacgtattgg agtgacctcc ggcgaaaaca cggctatgaa       480
     gagccgcata aaatcaaaac ctggtgcctt ggaaatgaaa tggatggtcc gtggcaggtt       540
     gggcagaaaa cggcctatga atacggcagg ctggccagcg aagcgggaaa agcgatgcgt       600
     cttgtggatc cggatattga gctggtgtca tgcgggagtt cacacacaca aatgccgaca       660
     ttcccggact gggaggcgga gaccctgacg cacacatacg atgtggctga ttacgtctct       720
     cttcatcagt atttcggtaa ccgggataac gattcgcaaa attatcttgc aaatgggatg       780
     gagctggaac attttatttc aacggtcatc tccgttgcgg attatatcaa agcgaaaaaa       840
     cgcagtaaaa agacgttgat gctgagcttt gatgagtgga atgtctggta tcactcgaac       900
     gatgcagaca aagaaattga gccttggacc gttgcgctac cgcagttgga ggaccattac       960
     aattttgaag atgccctttt ggtggggagt attctgatca catttttaaa gcacgcggat      1020
     cgggtgaaaa tggcttgcat ggcgcagttg gtgaacgtca ttgctccaat tatgacagat      1080
     aatctcggtg cgtcctggaa acagacgatt ttctatccgt atatgcatgc ttcagttttt      1140
     ggccgcgggg tatcgctcaa gccggtagtc aattcaccga aatttgatac gaaggatttc      1200
     acagacgtgg actatctgga tacggccgtt gtctttaacg aagagaatga agaactgacg      1260
     gtctttgcat taaaccgtca tattaaagaa gatcttgtta tggaagcgca gctcggtgat      1320
     tttgaagggt atcggattca ggaacatatt gtccttgaac atgatgatct aaaagcagtg      1380
     aatacagcga cgaatcatcc ggtaaagccc tacagaaatg gggatgctgt ttataaagac      1440
     ggtgtaattg aaacgaagct gaaaaaagct tcatggaacg taattcgtct gaagctcatc      1500
     aatgaatga                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page