(data stored in ACNUC7421 zone)

EMBL: CP001791.PE332

CP001791.PE332       Location/Qualifiers
FT   CDS_pept        358331..359449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0344"
FT                   /product="transcriptional regulator, GntR family with LacI
FT                   sensor"
FT                   /note="KEGG: vpa:VP1030 LacI family transcription
FT                   regulator; PFAM: regulatory protein GntR HTH; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97884"
FT                   /db_xref="GOA:D6XWP2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR033532"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWP2"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADH97884.1"
FT                   /translation="MEPKYNQVKNSIRSKILQGYFKPHEKIGSESELMQSYEVSRHTVR
FT                   KAIDDLVNEGWIYKKQGAGTFCAERSVSSDAVSNGTKNIAVITTYFSDYIFPTIIRGIE
FT                   GYLSANGYQMTVFSTNNDPDLERKYLETVLSGQFDGLIIEPTKSALPNPNINYYLNIER
FT                   LGIPYVMINAYYEELEPVHLIMNDAEGGRIATRQVIDEGHKQILGFFKNDDIQGIKRMK
FT                   GFIKAHRESGLQITPQNIVTYTTETRKKDPVERLKEKMKVRHERPTAIVCYNDQLAVIL
FT                   LDVLRDLNLSIPGDVSVIGFDDSFLSVASEVKLTTVKHPKERMGVDAAKLIDQLIREKE
FT                   DPTVSKKASSIVYEPELVVRNSTKDLKIKEVN"
     atggagccta aatataatca ggtgaaaaac agtatacgtt caaaaatttt gcagggatat        60
     tttaagccgc atgaaaaaat cggctctgaa agcgaactga tgcagtcgta tgaggtgagt       120
     cgtcatacgg tgcgaaaagc cattgatgat ctcgtcaatg aaggatggat ctataagaag       180
     cagggggccg gtacattctg tgccgagcgc tctgtttcat cagatgccgt gtccaatggc       240
     acgaagaaca tcgcggtcat tacgacgtac ttctcggact atatatttcc gacgattatc       300
     cgcgggatcg agggatatct gagtgcgaac gggtatcaga tgacggtatt cagtacgaac       360
     aatgatccgg atctcgagcg gaaatatctg gagacggtgc tgtccggtca gtttgacggt       420
     ttgattattg aaccgacgaa aagcgcgctc ccgaatccga acatcaacta ttatttaaac       480
     atcgagcgcc tcggtattcc gtacgtgatg atcaacgcct actacgaaga gctcgaaccg       540
     gtgcatctga tcatgaatga tgcagaaggc ggcaggattg cgacgaggca ggtcattgac       600
     gaaggacaca agcagattct cggtttcttt aagaatgatg atattcaggg gatcaagcgg       660
     atgaaagggt ttattaaggc ccaccgggaa agcggtctgc agattacacc gcaaaatatc       720
     gtgacctata caacggaaac gaggaagaag gatccggtgg agaggctgaa ggagaaaatg       780
     aaggtccgtc acgagcggcc gacagccatc gtctgttata acgatcagct tgccgtgata       840
     ctgctcgacg tcctgagaga tttaaatctg tccatcccgg gcgatgtttc cgtcatcgga       900
     tttgatgatt cgttcctttc tgtggcatca gaagtgaaat tgaccacggt aaagcacccg       960
     aaagagcgga tgggtgtgga cgcggcaaaa ctgatcgatc agctgatcag ggaaaaagaa      1020
     gatccgacgg tgtccaaaaa agccagttca attgtatatg aaccggaact ggttgtacgg      1080
     aactccacga aggatctgaa aataaaagag gtgaactga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page