(data stored in ACNUC7421 zone)

EMBL: CP001791.PE334

CP001791.PE334       Location/Qualifiers
FT   CDS_pept        complement(360759..361724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0346"
FT                   /product="selenide, water dikinase"
FT                   /note="KEGG: sfu:Sfum_3401 selenide, water dikinase;
FT                   TIGRFAM: selenide, water dikinase; PFAM: AIR synthase
FT                   related protein; AIR synthase related protein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97886"
FT                   /db_xref="GOA:D6XWP4"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWP4"
FT                   /inference="protein motif:TFAM:TIGR00476"
FT                   /protein_id="ADH97886.1"
FT                   /translation="MRHLPEGTKNENLLVGLDTSDDGGVFKLTDDLAIVQSIDYFTPIC
FT                   DDPYMFGQIAAANALSDIYAMGGKPVTALNIVGYPIKKMPPETLAEILRGGADKIQESG
FT                   AVLAGGHSIDDQEPKYGLSVTGTVHPDAIFKNVGAKTGDKLVLTKPLGAGIITTAIKFG
FT                   KASEQEQKDVMTAMATLNKTAAETLADFHPHAVTDVTGFGLTGHGFEMASGSNVTLHIS
FT                   YKDVPVINGTLSHARNKVIPGGGRENRDYLLEHVEHAPHIELADQLILSDSITSGGLLV
FT                   SLPADEADAYVEAYNRAQDTFKAAVIGHVTDFEGHAIKIR"
     ttgcgtcatt tacctgaagg aactaaaaac gaaaacctgc ttgtcggtct tgatacgagc        60
     gatgatggcg gtgtgtttaa actgacggac gatctcgcca ttgtgcagtc catcgattat       120
     ttcacgccaa tttgtgacga cccgtatatg tttggccaga tcgcagcggc aaatgcactg       180
     agtgacattt atgcgatggg cggtaaaccg gtcacggccc tgaacattgt cggatatccg       240
     atcaaaaaga tgccgccgga aacccttgct gagattctca ggggcggggc ggacaaaatc       300
     caggaatcag gggccgttct cgccgggggc cattccattg atgatcagga accaaaatac       360
     ggcctgagcg taaccggaac cgttcatccc gacgcgatct tcaagaacgt cggtgcgaaa       420
     accggtgaca agctcgtcct gacaaaacct ctcggagcag gcatcattac gacagccatt       480
     aaattcggca aggcaagtga acaggaacaa aaagacgtca tgaccgcgat ggcgacgctc       540
     aacaagaccg cagccgaaac actcgctgac tttcatcctc acgctgtcac ggatgtcacc       600
     ggattcggtc tcaccggtca cggctttgaa atggcaagcg gcagcaatgt caccctgcat       660
     atttcctaca aagacgtgcc agtcatcaac ggcaccttat cccacgccag aaacaaagtc       720
     attcctggcg gcggacgtga aaaccgcgac tatttgcttg agcatgtgga acatgccccg       780
     catattgaac ttgcggatca gctcattctc tcagactcca ttacgagcgg cggcctgctc       840
     gtcagcctgc cggcagatga agccgatgcg tatgttgaag cctataaccg ggcgcaggat       900
     acgttcaaag cagccgtcat tggacatgtg accgattttg aaggtcatgc catcaagatt       960
     cgctga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page