(data stored in ACNUC7421 zone)

EMBL: CP001791.PE336

CP001791.PE336       Location/Qualifiers
FT   CDS_pept        complement(362323..363195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0348"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: gem:GM21_2178 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97888"
FT                   /db_xref="GOA:D6XWP6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWP6"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADH97888.1"
FT                   /translation="MNLNRLHTFIVLAEERSFSQTAQKLKISQPAITKQIKALEKEAGF
FT                   PLLNRETMTLTTSGAILFNEGQKLLQDWEVIYNKAALSHAGEQGSLHVGASSIPGTYLL
FT                   PQALSLLEDSAYPTDLCITLDSSAKMIEQLRHFELDLAFTGSKPDDNRLVSTEIAQDQL
FT                   VLVGTPEKSAIHSADDLMNERFISYREGSGTLRATKKAITDFGGSFDDLPVIAVVPNTA
FT                   GALALAASGIGITAVSSFALDTVMTQHVKILCELPTDRSFYAVRHANSQHPHTDALIQA
FT                   MIQSATRQM"
     atgaacctga accgactgca caccttcatt gttcttgcag aagaacgaag cttctcccaa        60
     actgcccaaa agctcaagat ctcccaacct gcgatcacga agcagatcaa agcactggag       120
     aaagaagccg gctttccgct tcttaacagg gaaacgatga ccctgacgac gtcaggcgcc       180
     attttgttta acgagggaca aaaactgctt caggactggg aggtcatcta taacaaagcc       240
     gctttgagcc acgccggtga acagggaagt cttcacgtcg gggcaagctc cattcccggc       300
     acctatcttc ttccacaggc actttccctc cttgaggatt cggcgtatcc aacggatctc       360
     tgcatcacgc tcgactcctc cgcgaagatg atcgaacagt tgcgtcattt cgagcttgac       420
     cttgccttta ccgggtccaa gcccgatgat aaccgccttg tatcgacgga aatcgcccag       480
     gatcagctcg tcctggttgg cactccggag aaatcagcga tccattccgc tgatgatctg       540
     atgaatgagc gctttatttc ctacagagag ggttccggta cgctccgtgc gacaaaaaaa       600
     gccatcaccg attttggagg atctttcgat gatctgcccg tcattgccgt tgtcccgaat       660
     accgccggag ctctcgctct tgcggcatcc ggcatcggga tcaccgccgt gtcgtcattt       720
     gccctcgata cggtgatgac ccaacatgta aagattcttt gcgaactccc gaccgaccga       780
     tccttctacg cggtgcgtca cgccaacagc cagcatccgc acacggacgc cttaatccag       840
     gctatgatcc aatccgccac ccgtcagatg tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page