(data stored in ACNUC7421 zone)

EMBL: CP001791.PE337

CP001791.PE337       Location/Qualifiers
FT   CDS_pept        363335..364210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0349"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; KEGG: afw:Anae109_3021
FT                   phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97889"
FT                   /db_xref="GOA:D6XWP7"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWP7"
FT                   /inference="protein motif:TFAM:TIGR01098"
FT                   /protein_id="ADH97889.1"
FT                   /translation="MNVKRSLFILSGLFLLGACGNEQEEPFEVAVIPSQSIGEMQEGLD
FT                   LLEAELEAALGRVVKVEHYPNYNAVVEAINHSHIDLAYVGPVTYLIARNQSGAEAVLTQ
FT                   SINGSPYYHSYIKAHVDAPWDTLDELLADVGDVSFAFGSHSSTSGFTVPGYELMNQGVY
FT                   RDENDHDFIDVRFTGSHDITAQALLSQDVDAGAIDSAIYHALVEEGSVDDSRLKTIWES
FT                   EPLYQYPWIVPSDKDEDEIEAIQEAFLAIEEPEILRIFGGADAFVLADVANYEGIEDAA
FT                   RAVGLLDDEE"
     atgaatgtga agcgatcgtt gtttatttta agtggactgt tcctgcttgg cgcttgtggg        60
     aatgaacagg aggaaccgtt cgaagtcgcc gtcattccgt cacagtccat cggggaaatg       120
     caggaagggc ttgatctgct tgaggcagag cttgaagcag cgcttgggag agttgtcaaa       180
     gtggagcact atccgaacta taatgcggtg gtggaggcca tcaatcacag tcatatcgat       240
     ctcgcttatg tggggcctgt gacgtacctc atcgccagaa atcagagtgg ggctgaggca       300
     gttctgactc aatccatcaa tggatcgcct tattatcatt cctatatcaa agcgcatgtg       360
     gacgctccgt gggatactct cgatgagctg ttggcagatg tgggtgacgt gtcatttgct       420
     tttggcagtc attcctcgac gtcaggtttt acggtaccgg ggtatgagtt gatgaatcag       480
     ggggtgtacc gtgatgagaa tgaccatgac tttatagacg tccgctttac cggttcgcat       540
     gacattacag cccaggccct cctcagtcag gacgtggatg caggagccat tgacagtgcg       600
     atttatcacg cactcgtcga agaggggtct gtggatgaca gccggctgaa gacgatttgg       660
     gaatcggagc cgctttatca atatccgtgg atcgtccctt ctgataagga tgaagacgag       720
     atcgaagcca ttcaggaagc gtttcttgcg atcgaagagc cggagatttt acggattttc       780
     ggaggtgcag atgcctttgt cctggcagat gtggccaatt atgaagggat cgaggatgcg       840
     gcccgggccg tggggcttct tgatgatgag gagtaa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page