(data stored in ACNUC7421 zone)

EMBL: CP001791.PE34

CP001791.PE34        Location/Qualifiers
FT   CDS_pept        45933..46262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0035"
FT                   /product="protein of unknown function DUF970"
FT                   /note="PFAM: protein of unknown function DUF970"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97586"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV28"
FT                   /inference="protein motif:PFAM:PF06153"
FT                   /protein_id="ADH97586.1"
FT                   /translation="MKLIMAVIQDKDSNRLSDALVEHDFQATKLASTGGFLKAGNTTFM
FT                   IGVEDEHVNEVLTIINENCKAREQLVAPISPMGGNADSYVPYPVEVQVGGATVFVLPVD
FT                   QFEKF"
     atgaaactga tcatggctgt aattcaggat aaagacagca accgtctgtc cgatgccctg        60
     gtggaacatg actttcaggc aacgaaactg gcgagtaccg gcggattttt gaaggcggga       120
     aatacgacat tcatgatcgg tgtggaggat gaacatgtca atgaggtcct gacgatcatt       180
     aacgagaact gcaaggcacg cgaacagctc gttgcaccga tttcaccgat gggcggcaat       240
     gctgattcct atgtgccgta cccggtggaa gtgcaggttg gtggagcgac ggtcttcgtc       300
     ctcccggtgg atcagttcga gaaattttga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page