(data stored in ACNUC7421 zone)

EMBL: CP001791.PE341

CP001791.PE341       Location/Qualifiers
FT   CDS_pept        complement(366856..367710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0353"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dol:Dole_2764
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97893"
FT                   /db_xref="GOA:D6XWQ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97893.1"
FT                   /translation="MLNDLLENLPQIPISEAVSNAVAWITDVFSFIFGPIRSGFGDFMT
FT                   WFADLLYAVPALIIIVLVAVIAYFLNGRKLGLPIFTIFGLLLIFNQGLWEELMYTFTLV
FT                   LLASVLSVIIGVPFGILMSKSDTAEAIMKPVLDFMQTMPAFVYLIPAVAFFGIGMVPGV
FT                   FASLIFATPPTVRLTNLGIRQVPTEMVEASDAFGSTPAQKLFKVELPMAKVTIMAGINQ
FT                   TVMLALSMVVIASMIGAPGLGREVLSALQRAQVGPGFTAGIAIVILAIIIDRFTQTANM
FT                   KKN"
     atgttgaatg atcttttaga aaacttaccg caaataccga tttctgaagc cgtcagtaac        60
     gcggttgcgt ggatcaccga tgtcttttcc tttatcttcg gtccgatccg cagtggcttt       120
     ggtgatttta tgacctggtt tgccgatctg ctctatgcag tgccggcact cattatcatc       180
     gttttggtcg ctgttattgc ctatttcctg aatggcagga agctcggact gccgatattc       240
     accatattcg gtctcctgtt aatctttaac cagggactgt gggaagaact catgtacacc       300
     tttacccttg tccttctcgc cagtgtcctt tccgtcatca tcggggttcc attcgggatt       360
     ctcatgtcga aaagcgacac cgcagaagcg atcatgaagc cggttctcga cttcatgcag       420
     acgatgccgg ccttcgttta tctgattccg gccgttgctt tcttcgggat cgggatggta       480
     ccgggtgtat tcgcctcact gatttttgcg acaccgccga cggtccgact gacgaatctc       540
     gggatccggc aggtaccgac ggaaatggtc gaagcctcgg atgcatttgg ttcgacaccg       600
     gcacagaagc tctttaaagt tgagctgcca atggccaaag ttaccatcat ggccgggatt       660
     aaccagaccg tgatgctcgc cctttccatg gttgtcattg cttccatgat cggggcacct       720
     ggtcttggcc gtgaagtgct gtctgccttg cagcgtgctc aggttggacc tggctttaca       780
     gcaggtatcg ccattgttat actggcgatc atcatcgacc gcttcaccca aacagcaaac       840
     atgaagaaga attaa                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page