(data stored in ACNUC7421 zone)

EMBL: CP001791.PE342

CP001791.PE342       Location/Qualifiers
FT   CDS_pept        complement(367700..368899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0354"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: glycine betaine/L-proline ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; CBS domain
FT                   containing protein; KEGG: aeh:Mlg_0732 glycine
FT                   betaine/L-proline ABC transporter, ATPase subunit; SMART:
FT                   AAA ATPase; CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97894"
FT                   /db_xref="GOA:D6XWQ2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ2"
FT                   /inference="protein motif:TFAM:TIGR01186"
FT                   /protein_id="ADH97894.1"
FT                   /translation="MATIKVDKLTKIFGKKTKQAQQLLDQGLSKDEILEKTGATVGVNQ
FT                   ASFEVQDGEIFVIMGLSGSGKSTLVRLLNRLIEPTSGSVIINGDDLSNISDDKLRDVRR
FT                   KMMSMVFQKFGLFPFRTIMENVEYGLEVQGIEREERRKKAQASLELVGLKGYEEQYPDQ
FT                   LSGGMQQRVGLARALANDPEVLLMDEAFSALDPLIRKDMQDELLDLQTSMKKTIIFITH
FT                   DLDEALRLGDRIALMKDGYIVQIGTPEEILIHPADDYVERFVEDIDRSKILTAQHIMKT
FT                   PETINIDKNGPRVALERMRKYGLSSLYVTDSNRRLKGYITADDASDAQKRDSRELTDIL
FT                   KTDMPTVGKETPLHDLFDLIHDSPVPVAVVEDEKLEGIIVRGAVIAALSGENEVNLDVE
FT                   "
     gtggctacaa ttaaagtcga caaactgact aagatttttg gcaagaagac aaaacaagcc        60
     cagcagctcc ttgatcaagg tctcagtaaa gacgagatcc tcgaaaaaac cggcgcaacc       120
     gtcggggtca accaggcttc cttcgaagtc caggacgggg aaatcttcgt gatcatgggc       180
     ctttcaggga gtggtaagtc tacacttgtc cggttattga accgtttaat cgaaccgaca       240
     agcggcagtg tcatcattaa cggtgatgac ctatccaaca tttcagatga taagcttcgg       300
     gatgtcagac gtaagatgat gagtatggta ttccagaaat tcggtctgtt cccgttccgt       360
     accattatgg aaaatgtgga atacggcttg gaagttcagg gcatcgaacg cgaggaacgc       420
     cgcaaaaagg cacaggcatc cctcgagctc gttggcctga aaggctacga agaacagtat       480
     ccggatcaac tgtccggggg gatgcagcag cgtgtcggtc tcgcaagagc cctcgccaat       540
     gaccctgaag tactcctgat ggatgaagca ttctctgcac tagatccact gatccgtaaa       600
     gatatgcagg atgagctttt ggacctgcag acgtccatga agaagacgat catcttcatc       660
     acgcacgacc tcgatgaggc actgcgtctc ggtgaccgca ttgcgctgat gaaggatggc       720
     tatatcgtgc agattggcac accggaagaa atcctcatcc atccggctga tgactatgtt       780
     gaacgcttcg ttgaggatat tgaccgctcg aagatcctca cggcccagca tattatgaag       840
     acaccggaaa ccatcaatat tgataaaaac ggtccccgcg ttgcccttga gcgcatgcgg       900
     aaatacggat tgtccagtct ttatgtaaca gacagcaacc gcagactgaa aggctacatt       960
     acggcggatg atgcgtctga tgcacaaaaa cgtgacagcc gtgaactgac cgatattctg      1020
     aaaacggaca tgccgacagt cggcaaagaa acaccgctcc acgatctgtt tgatctcatt      1080
     cacgattcac cggttccggt tgcggttgtc gaagacgaga aacttgaagg cattatcgtg      1140
     cgcggcgccg ttattgccgc tttgtccgga gaaaacgagg tgaacctgga tgttgaatga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page