(data stored in ACNUC7421 zone)

EMBL: CP001791.PE343

CP001791.PE343       Location/Qualifiers
FT   CDS_pept        369169..369720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0355"
FT                   /product="transcriptional regulator protein-like protein"
FT                   /note="KEGG: bja:bll3994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97895"
FT                   /db_xref="GOA:D6XWQ3"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ3"
FT                   /inference="protein motif:COG:COG1510"
FT                   /protein_id="ADH97895.1"
FT                   /translation="MSSEEKLLSEQEQLDAARGRFISEIAKNIHLYDLPPSIGRLYGTV
FT                   FFSKDPMTLDEMSEEMGMSKTSMSTGIRSLVEADMVERVWEKGVRKDLYKTEEDWYKSF
FT                   STVFIKRWRNATETNLEAIGETEEMLNALKERADHDEVIDEVNIDLEKLHRARKYYEWL
FT                   NEVIALFETGEIFEIVPKKE"
     atgtcaagtg aggagaagtt attaagcgaa caggaacagc ttgatgctgc ccgtggccga        60
     tttatttcgg aaatcgccaa aaacattcac ttatacgatt tgcctccgtc gattggcagg       120
     ctgtatggaa cggtgttctt ttcaaaggac ccaatgacgc tcgatgagat gagtgaagaa       180
     atgggcatga gtaagacgag catgagtacg gggatccgtt cgctcgttga ggcagatatg       240
     gtggaacggg tctgggagaa gggcgtccgt aaagatctct ataaaacgga ggaagactgg       300
     tataaatcct tctccaccgt gtttatcaaa cgctggcgaa atgcgacgga gaccaatctc       360
     gaagcgattg gtgagaccga agagatgctg aacgcattaa aagaacgtgc cgatcatgac       420
     gaagtgattg acgaggtcaa cattgacctt gagaaactgc atcgtgcgcg taagtattat       480
     gaatggctga atgaggtcat cgcgctcttt gagaccggag agatctttga gatcgtcccg       540
     aaaaaagaat aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page