(data stored in ACNUC7421 zone)

EMBL: CP001791.PE344

CP001791.PE344       Location/Qualifiers
FT   CDS_pept        369813..370409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0356"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97896"
FT                   /db_xref="GOA:D6XWQ4"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ4"
FT                   /inference="protein motif:PFAM:PF03748"
FT                   /protein_id="ADH97896.1"
FT                   /translation="MADDRKSMEQLQDKVNGKLADEEKTRQRPKNVATWRTEKPAVMNN
FT                   GPADFQPKKEKPKKNKPLMILAVLLVAFGGMMLLAFNEDRVMSAYQYITGDYSWQRAHH
FT                   ADEDMFRLSDGNYVQASVTIEVEERGQVRRLNSQDDSVDHIIEEAFMTVNTAEIRSNPG
FT                   KDQVVDEISAMINRDIEGVEVKQVYFRSILSPLAN"
     atggcggatg atcgaaaatc aatggaacag ttgcaggata aagtgaacgg gaagctggcc        60
     gatgaagaga aaaccaggca gcggcccaaa aatgtggcaa cctggcggac ggaaaaaccg       120
     gcggtgatga acaatggacc ggcggacttt cagccgaaaa aagaaaagcc aaaaaagaat       180
     aaaccgctca tgattttagc ggttttactt gtggcctttg gcggcatgat gctgctggcc       240
     ttcaatgaag accgggtgat gtccgcttat cagtatatca ccggtgatta ttcttggcag       300
     cgtgcgcatc atgccgatga agacatgttc cgtctttctg acggtaacta tgtacaggct       360
     tctgtgacta ttgaagtgga agagcgtggg caggttcgcc gtctgaacag ccaggatgac       420
     tctgtcgacc atatcattga agaggcattt atgaccgtaa acactgcgga gatccgctcg       480
     aaccccggca aggaccaggt ggttgacgag atttctgcca tgattaaccg ggatatagaa       540
     ggggtggagg tcaaacaggt gtatttccgc tcgattttat cgccccttgc aaactga          597
//

If you have problems or comments...

PBIL Back to PBIL home page