(data stored in ACNUC7421 zone)

EMBL: CP001791.PE348

CP001791.PE348       Location/Qualifiers
FT   CDS_pept        372202..373974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0360"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ppr:PBPRA0971 putative transport ATP-binding
FT                   protein MsbA; PFAM: ABC transporter related; ABC
FT                   transporter transmembrane region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97900"
FT                   /db_xref="GOA:D6XWQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH97900.1"
FT                   /translation="MFAALKKLSWFFKQEKKRYIIAILILTVASVLEIIPPRLIGFVVD
FT                   DVHQGRMTEERLFGFVSFFIVLMLVVYVMTYVWMRKLFGGSLLLERTMRSRLMNHLMTM
FT                   TPSFYNRNKTGDLMAKGTNDLKAISQTAGFGILTLVDATVFLVVILVMMTVFISWELTL
FT                   AAFLPFPLMAYLMKVYGKRIHERFMAAQRAFGDLNDQVLESISGVRVIRAFVKEQADRT
FT                   SFSKQTDHVLRQNIRVARVDALFEPTIKILVGMSYMIGLGFGAYLVFQGRITLGQLVTF
FT                   NIYLGMLIWPMFALGELMNIMQRGNASLDRLNHTFEAEPDVKDPDKPLRDLVPNEIVFD
FT                   GLNFSYPKAKEPALSDVSVTIRKGMHIGVAGKTGSGKSTFLRQLLRAYPLHKGALKVNS
FT                   VPFEQVSLSTVKGWIGYVPQESFLFSKSIEANIRFGAGDKVSDDRLRQVMEQAAITKDL
FT                   HTFQDGLETLVGEKGISLSGGQKQRIAIARALMKDPEILILDDAMSAVDAKTEQFIISN
FT                   IREERSGKTTFIAAHRMSAISHADVILVFDGGRIVEQGTHDELMQNGAWYKEQFDKQQM
FT                   EQQSQEQARQGVSS"
     atgttcgcag cattaaagaa attatcatgg ttttttaaac aggaaaagaa acggtatatc        60
     attgctattc tcatcttaac ggtggcgagt gtcctcgaaa tcatcccgcc gcggctcatc       120
     ggatttgtgg tggatgatgt gcaccaggga cggatgacgg aggaacgtct ttttggcttc       180
     gtcagctttt tcattgtgct catgctcgtt gtctacgtga tgacgtatgt ctggatgcgc       240
     aaactgtttg ggggttcttt gctgctagaa cggacgatgc gttcaaggct gatgaatcat       300
     ctgatgacga tgacgccgtc cttttataac cggaataaaa ccggcgatct catggcaaaa       360
     ggaacgaacg atctgaaggc gatttcacag acggcagggt tcgggatcct caccctcgtt       420
     gatgcaacgg tctttctcgt ggtcattctc gttatgatga cggtatttat cagctgggag       480
     ctgacgttgg ctgccttttt gccgttcccg ttgatggctt atttaatgaa ggtttatggt       540
     aagcgcatac atgaacggtt catggcagcg cagcgtgcat tcggggatct gaatgatcag       600
     gtgcttgaat cgatctctgg tgtgcgggtc attcgggcct ttgtcaaaga acaggccgac       660
     cggacctcgt tcagtaagca gaccgatcat gtcctccggc agaacatccg ggtggcgagg       720
     gtggatgccc tctttgagcc gacgattaag attctcgtcg ggatgagcta tatgatcggc       780
     ctcggctttg gggcgtacct cgtctttcag gggcggatta ccctcggtca gctcgtgacg       840
     tttaatattt acctcgggat gctgatttgg ccgatgttcg ccctcggcga actgatgaat       900
     attatgcagc gggggaatgc gtcactggac aggcttaatc acacctttga ggcagagccg       960
     gatgtgaagg atcctgataa accgctgaga gacctcgtac cgaacgaaat tgtctttgat      1020
     gggctcaact tcagctatcc aaaggcgaaa gaaccggcgc tgtccgatgt gtcggtcacg      1080
     atcagaaaag ggatgcacat cggtgttgcg gggaagacgg gaagtgggaa atccaccttt      1140
     ctcaggcagc ttctgagagc gtatcctctt cataaaggag cgctgaaggt caacagcgtg      1200
     cccttcgaac aggtatccct ctccacggtg aaaggatgga tcggctacgt gccgcaggag      1260
     tcatttctgt tttccaagtc gattgaagca aacatccgct ttggagcggg ggataaggtg      1320
     tcggatgaca ggctcaggca agtcatggaa caggcggcga ttacgaaaga tctgcacaca      1380
     ttccaggatg gcctcgaaac ccttgtcgga gaaaaaggga tctctctttc cggcggccaa      1440
     aagcagcgga ttgccatcgc gagagcgctg atgaaggatc cggaaatcct gattcttgat      1500
     gacgccatgt cggcggtgga tgcgaaaacg gaacagttta tcatctcgaa catccgcgag      1560
     gagcgaagcg ggaaaacaac gtttatcgcc gcgcaccgta tgtctgcgat cagtcatgcg      1620
     gacgtgattc ttgtttttga cggcggacgg attgtcgaac agggaacgca tgatgaactg      1680
     atgcaaaacg gcgcctggta caaagagcag tttgacaagc aacaaatgga acaacagtca      1740
     caggaacagg ccaggcaggg ggtgtcttca tga                                   1773
//

If you have problems or comments...

PBIL Back to PBIL home page