(data stored in ACNUC7421 zone)

EMBL: CP001791.PE35

CP001791.PE35        Location/Qualifiers
FT   CDS_pept        46299..47291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0036"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: geo:Geob_2151 DNA polymerase III, delta prime
FT                   subunit; TIGRFAM: DNA polymerase III, delta prime subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97587"
FT                   /db_xref="GOA:D6XV29"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV29"
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /protein_id="ADH97587.1"
FT                   /translation="MALDFTAAEKTQPVAAGILKRTIEKNRLAHAYLFEGSRGTGKQEI
FT                   AKLVAKAFLCQVRESADPCGDCGDCRRVDSGNHPDVHLIEPDGTTIKVEQIRGLKKEFS
FT                   MRGMESGRKVYLVQDADLMTASAGNSLLKFLEEPDGEALAILMTTRPQRILKTILSRVQ
FT                   VLSFHPLAPDEFVKTLVNHDVKERDALLLSRMTSNLDEALSMTEEDWIAEARNKVIQLI
FT                   DDLVTRPGYSLISLQDDWIPFFKEKTDVQLGIDLMTLWYRDVLRTKVDQMEQIVYVDQE
FT                   DRLQKQAFSLSEERLARHLEAIVDTKRRIDANTTPQLAMEQMLIRLQEG"
     atggcattgg actttacagc ggcagagaag acacagccgg tggcggcagg catactcaaa        60
     aggacaattg agaagaaccg tcttgcccac gcgtaccttt ttgaaggcag ccggggaacg       120
     ggtaagcagg agatcgcgaa gcttgtcgcg aaggcttttc tctgccaggt ccgggaatct       180
     gcggatcctt gcggggactg cggagactgc cggagagtgg attcgggcaa tcatccggat       240
     gtccacctca ttgaacccga cggtacgacg atcaaggtcg aacagatccg cggcctgaaa       300
     aaggaattca gcatgcgcgg gatggagtcg gggcgcaagg tatacctcgt tcaggatgcc       360
     gatctcatga cggcctctgc cggaaacagt ctcttgaagt ttcttgagga acctgacggc       420
     gaggcgctgg cgatcctgat gacgactcgt ccgcaacgga ttctgaagac gatcctttca       480
     agggtgcagg tcctgtcctt tcaccctctg gctccggatg aatttgtcaa aaccctcgtc       540
     aaccatgacg tgaaggaacg cgatgccctc ctgctgtcac gaatgacctc gaaccttgat       600
     gaagccctca gcatgaccga agaggattgg attgcagaag caagaaacaa agtgatacaa       660
     ttgattgatg atcttgttac aagaccaggg tattccctca tttcactgca ggatgactgg       720
     ataccttttt tcaaggaaaa aaccgatgtg cagctgggaa tcgatctgat gacgctctgg       780
     taccgggatg tgctccggac caaggtggat cagatggaac agatcgtgta tgtggatcag       840
     gaagacaggc tgcaaaaaca ggccttctcc ctttcggagg agcgccttgc caggcatctt       900
     gaggccatag tggatacgaa gcggcggatt gatgccaaca cgacgccaca gctcgcgatg       960
     gaacagatgc tcattcggtt acaggaggga taa                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page