(data stored in ACNUC7421 zone)

EMBL: CP001791.PE354

CP001791.PE354       Location/Qualifiers
FT   CDS_pept        complement(379933..381363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0366"
FT                   /product="amino acid carrier protein"
FT                   /note="KEGG: vpa:VP0503 sodium/alanine symporter; TIGRFAM:
FT                   amino acid carrier protein; PFAM: sodium:alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97906"
FT                   /db_xref="GOA:D6XWR4"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWR4"
FT                   /inference="protein motif:TFAM:TIGR00835"
FT                   /protein_id="ADH97906.1"
FT                   /translation="MEATLIHTIILDGVNSLVDWGNNLLWTYILIGLLIGLGVYFTFAT
FT                   KFVQFRLFKEMFRVITEKKDGTNGISPFQAFTISTASRVGTGNLTGVALAISIGGPGAV
FT                   FWMWMVAIIGMATAFIESTLAQVYKVRDGDQFRGGPAYYMEKAIGSRALGVVFAILLTL
FT                   CFGLVFNAVQANTIADAFDGAFGFNPLYMGIVIAAVAGIVIFGGVRRIARVTQIVVPFM
FT                   AVAYLLIATYVVITNFALIPDVFMLIVSNAFGVGEIIGGGVGAAIMQGVRRGLFSNEAG
FT                   MGSVPNAAATANVSHPAKQGLVQSLGVFFDTIIICSATAFLILLTDVYTVDGAEGIQLT
FT                   QDAMSAHVGEWAVYFVAIAILFFAFISIIGNYYYGETNIEFIRSNSNWLYAYRFAVIGM
FT                   VIFGSVAQVGLVWNLADLFMGLMAVLNLIAIFLIGKVALAVLNDYTTQLDSGKNPVFKA
FT                   SHIPDLKHAECWEDEQSS"
     atggaagcca ctctcattca taccatcatc cttgatggcg tcaacagcct tgtcgactgg        60
     ggcaacaacc tgctatggac atacatatta atcgggctgt taatcgggct cggtgtttat       120
     ttcacgtttg cgacgaaatt cgttcagttt cgcctgttta aagaaatgtt ccgggtcatc       180
     actgagaaaa aagacggcac gaacggcatt tctccttttc aggccttcac catcagtacg       240
     gcatcgcgcg ttggaacagg caatctcacc ggtgtcgccc tcgcgatctc aatcggcggg       300
     ccgggcgctg tattctggat gtggatggtc gcgatcatcg ggatggcgac tgcatttatc       360
     gaaagtaccc ttgcacaggt ctacaaagtc cgcgacggtg atcagtttcg gggcggaccg       420
     gcctattaca tggaaaaagc catcggaagc cgggctcttg gggtcgtttt tgccatcctt       480
     ctcacccttt gtttcggcct cgtcttcaat gccgtgcagg ccaacaccat tgccgatgcc       540
     tttgacggtg cattcggctt taatccgctt tatatgggaa tcgtcatcgc cgcagtcgcc       600
     gggatcgtga tcttcggcgg ggtaaggcga attgccagag tcacacagat tgtcgttcct       660
     ttcatggctg tcgcctattt gctgattgcc acctatgtgg tcatcaccaa tttcgctctt       720
     attcctgacg tctttatgct gattgtgtcc aatgcattcg gcgtcggtga gatcatcggg       780
     ggcggtgtag gcgctgcgat tatgcaagga gtccggcgcg gtctcttctc caatgaggcc       840
     gggatgggca gtgtgccaaa cgctgctgca acagcaaacg tcagccatcc ggcaaaacaa       900
     gggctcgtcc agagtcttgg tgtcttcttc gatacgatca tcatctgctc ggccaccgcg       960
     tttctcatcc tgctcactga cgtttatacg gtggacggcg ctgaaggcat tcagctcaca      1020
     caggatgcca tgagtgcgca tgtcggagaa tgggccgttt actttgtcgc catcgcgatt      1080
     ttattcttcg ccttcatttc catcatcggg aactattatt acggcgagac gaatattgaa      1140
     ttcatccgtt ccaactcaaa ctggctttat gcctaccgtt ttgcagtcat aggcatggtg      1200
     attttcggtt ccgttgcgca ggtggggctc gtatggaacc ttgccgacct ctttatgggg      1260
     ctcatggccg tgctgaacct gatcgcgatc ttcctgatcg gcaaagttgc cctggctgtc      1320
     ctgaacgact acaccactca gcttgattca gggaagaatc cggtctttaa ggcgagccat      1380
     attcctgatt taaaacacgc agagtgctgg gaagatgagc agtcatcctg a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page