(data stored in ACNUC7421 zone)

EMBL: CP001791.PE357

CP001791.PE357       Location/Qualifiers
FT   CDS_pept        384774..385445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97909"
FT                   /db_xref="GOA:D6XWR7"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWR7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97909.1"
FT                   /translation="MAVNARKVVFLFWSTLLIGTVAGTIIGLIQGIGGYFMVIVTAALW
FT                   TVIAQMGFFAYLTIHRFGLGMFKSVSLWNKVQLVIIAFAFFDLMFFRHYFFATDDETML
FT                   GYAIMPTLLLVYALIVAYLKAKDTNRHAFIPALFFMYVVTMIEWIPAFTGNDLNFIINA
FT                   VVPLLVANTWQLLVLHRLHEMPNGRQPTVEQWSKWEKEGFEERKREKETKKNRKKARKN
FT                   A"
     atggctgtga acgccaggaa agtagtcttt ttgttttggt caacgttact tatcggtacc        60
     gttgcaggaa caatcatcgg gctgatccag gggatcggcg gttatttcat ggtgattgtg       120
     acggcggcgc tttggaccgt gatcgcacag atgggtttct ttgcgtattt aacgattcac       180
     cgcttcggac tcggaatgtt taagtccgtg tcgttatgga ataaagtcca acttgtcatt       240
     attgcgtttg cctttttcga tctgatgttc tttcggcatt atttctttgc gacggatgat       300
     gagacgatgc tcggctacgc gattatgccg accctgttgt tggtctatgc gctgattgtc       360
     gcctatctga aggcgaaaga tacgaatcgg cacgcattta ttccggcgct tttcttcatg       420
     tacgtcgtca cgatgattga gtggatcccg gcctttacag ggaacgatct gaactttatc       480
     atcaatgcgg tcgtaccgct tctcgttgcc aacacgtggc agcttctcgt tttgcacagg       540
     ctgcacgaga tgccaaacgg cagacagccg acggtcgaac agtggtccaa atgggaaaag       600
     gaaggatttg aagagcggaa acgggaaaaa gaaacgaaaa aaaatcgcaa aaaagcccgg       660
     aaaaacgctt ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page