(data stored in ACNUC7421 zone)

EMBL: CP001791.PE360

CP001791.PE360       Location/Qualifiers
FT   CDS_pept        387688..388506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0372"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; KEGG:
FT                   pca:Pcar_0999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97912"
FT                   /db_xref="GOA:D6XWS0"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWS0"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ADH97912.1"
FT                   /translation="MFEDLTFWRLVAIVVDITLVAFVIYKLIMVIRGTRAVQLVKGITV
FT                   ILTVWFLSGYFGLHTLQWLMQQAVIYGVLAIIIIFQPELRRALEHLGRGKLFQSSSTAN
FT                   AEEIEEMIEHLIKSTNYMGKRRIGALISIERETGMNDYIETGVKLNANLTTELMTNIFI
FT                   PNAPLHDGAVVLQNGSIAAAGCYLPLSENPFISKELGTRHRAALGVSEVTDALTLVVSE
FT                   ETGAISMTKNGELHRNLDQDHLRKMLEKELMNKEEDKGTSRWQWGGRNNG"
     atgtttgaag acttgacgtt ctggcggctt gtggcgattg tcgtagacat aacccttgtt        60
     gcctttgtaa tttataaatt gattatggtg atccgcggga cgagggcggt tcagctcgtg       120
     aaagggatca ccgttatttt gacagtatgg ttcttaagtg gctattttgg attacatacc       180
     ttgcagtggc tgatgcaaca ggcggtcatc tatggtgtgc tggccattat cattattttt       240
     cagcctgaac tccggcgtgc cctggaacat ctcggacggg gcaaactgtt ccagagctcc       300
     tcgacagcga atgcagagga gatcgaagag atgatcgaac atctcatcaa gtccacgaac       360
     tatatgggca agcggcggat cggggctttg atctccatcg aacgggagac aggcatgaac       420
     gattacatcg agaccggcgt caagctgaat gcgaacctga cgacggaact gatgacgaat       480
     atattcatcc cgaatgcgcc gcttcatgac ggagcagtcg ttctgcaaaa tggcagcatc       540
     gccgcagcgg gctgttattt gccgctttcg gagaatccgt ttatttcgaa ggaactcggt       600
     acgcgtcacc gcgcggctct tggcgtcagc gaagtgacgg atgccctgac gctcgttgtc       660
     agtgaggaaa cgggtgccat ctccatgacc aaaaacggtg aactgcaccg gaacctcgat       720
     caggaccatt tacgaaagat gctcgagaaa gaactgatga ataaagagga agacaaaggg       780
     acttcccgtt ggcagtgggg agggagaaat aatggataa                              819
//

If you have problems or comments...

PBIL Back to PBIL home page