(data stored in ACNUC7421 zone)

EMBL: CP001791.PE361

CP001791.PE361       Location/Qualifiers
FT   CDS_pept        388499..389803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0373"
FT                   /product="YbbR family protein"
FT                   /note="PFAM: YbbR family protein; KEGG: fimbriae-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97913"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX56"
FT                   /inference="protein motif:PFAM:PF07949"
FT                   /protein_id="ADH97913.1"
FT                   /translation="MDKLFEKKWFIKVGSVAIAILLFLMVNSDGTTTTTGGLPGITDGS
FT                   RVIEEAQLNVYYDDENYVLTEAPETVQATLRGPQNVLTFSQVTQGQQEFFVDLTDKEPG
FT                   VHYERVQHRGFPADLSISIVPMTVRVVIQEQQTVSFPVEVDIENEGMIAEGYQVGEPVV
FT                   DPSTVDVRAGIGIVEQIAGARASVNVEGADNDVSGSFPVVFVDGNGTELELTANPAAVD
FT                   ITVPITAPNKTVPVRIGREGELDEGLAIDDISFDPSEVTIYGPVDVINDISFIDLDPLD
FT                   LSGLDGSVVTEKDVIVPQGVESVDPETVDVSVDVVEESERVFQDYEIIVENESDEQNVT
FT                   FVEPDGGMFDLTVSGSDELLQRLERSDIQASIDVEDLEAGEHEVTVTFDGPQHLRFVDE
FT                   GLTVVIEIGNGDITASNSETNDEEEEDETPESDSS"
     atggataagc tctttgagaa gaagtggttc atcaaggtcg gctcggtggc gattgccatt        60
     ctgctgtttc tgatggtcaa ttccgacggg acgaccacaa caaccggagg gctgccgggc       120
     attaccgacg gctcgagggt gatcgaagag gcacagctga atgtgtatta tgatgacgag       180
     aactatgtgt tgaccgaggc accggaaacg gtccaggcaa cgttaagggg accgcagaac       240
     gtcctcacct tttcgcaggt gacgcaggga cagcaggaat tctttgtgga tttgacagac       300
     aaggagcctg gggtgcatta tgaacgggtg cagcaccggg gattccctgc ggatctgtct       360
     atctccatcg ttccgatgac ggtgcgtgtc gtgattcagg aacagcagac tgtatctttc       420
     cctgttgaag tggatattga gaacgaaggt atgattgccg aaggctacca ggtcggtgag       480
     cccgttgtcg atccgtccac ggtcgatgtc cgtgccggca ttggcattgt ggaacaaatt       540
     gccggtgcga gagcctccgt taatgtggaa ggcgctgata atgacgtatc cggttcgttc       600
     cctgtcgtct ttgtcgacgg caacggaacg gaactggaac tgacagcaaa cccggctgcg       660
     gtggatatta ccgtgccgat taccgcaccg aataaaaccg tgccggtgag aatcgggcgg       720
     gaaggggagc ttgatgaggg gcttgccatc gatgatattt cctttgatcc gtctgaggtg       780
     acgatttacg gaccggtgga tgtgatcaac gacatcagtt tcattgatct tgatcctctt       840
     gacctttcag gattggatgg cagtgtggtg acggagaaag acgtcattgt ccctcaaggc       900
     gtggagtcag ttgaccctga gacggtcgat gtgtccgtag acgtggttga agaatccgaa       960
     cgggtttttc aggattacga gatcatcgtg gagaatgaat cagatgaaca gaatgtaacg      1020
     tttgtcgagc ctgacggagg catgtttgac ttaaccgtca gcggcagcga tgaacttttg      1080
     cagcggttgg agcgttcgga tattcaggca agcatcgacg tggaagatct tgaagcgggc      1140
     gagcatgagg taacggtcac ctttgacggc cctcagcatc tccgctttgt tgatgaaggg      1200
     cttaccgttg taattgaaat agggaatggt gacatcacag cttcaaacag tgaaacgaat      1260
     gatgaagaag aggaagacga gacaccggag agcgattctt cgtaa                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page