(data stored in ACNUC7421 zone)

EMBL: CP001791.PE363

CP001791.PE363       Location/Qualifiers
FT   CDS_pept        391399..391773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0375"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: vha:VIBHAR_07005 hypothetical protein; PFAM:
FT                   regulatory protein GntR HTH; SMART: regulatory protein GntR
FT                   HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97915"
FT                   /db_xref="GOA:D6XX58"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX58"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADH97915.1"
FT                   /translation="MVNFHDKKPIYLQIKEKIETLIVHDQLRPGERIPSTNELVQLYKV
FT                   NHLTVAKGINLLVEEGLVYKKRGVGMFVEEGAKETVQGTRKEAFKEDYLLPMLEEAEKI
FT                   GMSEEEIIHMIRIWKERDGQ"
     atggtgaact ttcatgataa aaaaccgatc taccttcaga ttaaggagaa gattgagacc        60
     ctgatcgttc atgatcagct gaggcccggt gaacggatcc cttcgacgaa cgagctcgtg       120
     cagctttata aagtcaatca tctgaccgtt gcgaagggaa ttaacctcct cgtggaagag       180
     ggactcgtct ataagaaacg gggtgttggc atgtttgttg aggagggtgc aaaagaaacg       240
     gttcaaggaa cgagaaaaga agcgttcaaa gaggattatc tcctgccgat gcttgaagaa       300
     gcggagaaaa ttggcatgtc ggaagaagaa attattcaca tgatcaggat atggaaggag       360
     cgtgatgggc aatga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page