(data stored in ACNUC7421 zone)

EMBL: CP001791.PE366

CP001791.PE366       Location/Qualifiers
FT   CDS_pept        393868..395673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0378"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="KEGG: gbm:Gbem_0090
FT                   glucosamine--fructose-6-phosphate aminotransferase,
FT                   isomerizing; TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: sugar isomerase (SIS);
FT                   glutamine amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97918"
FT                   /db_xref="GOA:D6XX61"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX61"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ADH97918.1"
FT                   /translation="MCGIVGYAGTAAANEILLKGLERLEYRGYDSAGIALVNGDGVHVY
FT                   KEKGRIAILRDSMDQAQPGPVGIGHTRWATHGAPSQVNAHPHQSRSGRFTLVHNGVIEN
FT                   YEYVQREYLADVEMVSDTDTEIIVQLIEKFANEDGMQTEEAFRKTLSLLKGSYATALLD
FT                   ELNPETIYVGKNKSPLLVGLADGVNVVASDAMAMLQVTNEFVEIMDGEMVIVTRDDVQI
FT                   KSVDGDTVTRDSYIAEIDSTDIEKGTYPHFMLKEIEEQPFTMRNIITKYKDENENIKLD
FT                   EHIRQAVLDADRIYIIAAGTSFNAGLVGKEMIEKIAQIPVETHIASEFLYNMPILSQNP
FT                   LFIFISQSGETADCRGVLVNVKELGHKTLTITNVPGSTLSREADYTLHTYAGPEIAVAS
FT                   TKAYTAQMAVLAILSVDTARAKGIEIDFDPMQQLGIVANAMDIFMEKKDELEQMARDYL
FT                   SVTRNCFYIGRGMDYHVCMEASLKLKEISYIQAEGFAGGELKHGTIALIEEGTPVVGLA
FT                   TQESVHLNLRGNMKEVVARGANPLMISMEGFEEADDKIVIPRVHELFTPLVSVIPMQFI
FT                   AYYAALHRGCDVDKPRNLAKSVTVE"
     atgtgtggaa tcgtaggtta tgcaggaaca gctgcagcaa atgaaatctt attaaaagga        60
     cttgaacgtc ttgaataccg gggctatgac tccgccggta tcgcgctcgt gaatggagac       120
     ggggttcacg tatacaagga gaagggccgg attgccattc tccgtgattc catggaccag       180
     gcccagccgg gaccggtcgg gatcggacat acacgctggg cgactcacgg cgcaccaagc       240
     caggtcaacg cccacccgca tcagagcaga tccggacgct tcaccctcgt tcataacggg       300
     gttatcgaga actatgagta tgtgcagcgc gagtatcttg cggatgtgga gatggtcagt       360
     gataccgata cggagatcat cgtccagctg attgagaagt tcgctaatga agacggcatg       420
     cagacggaag aagcgttcag aaagacgctc agcctgctga aaggatctta tgcgacggca       480
     ctccttgatg agctgaatcc ggaaacgatc tatgtaggga agaacaaaag cccgcttctc       540
     gtcggtcttg ccgatggcgt gaacgtggtg gcaagtgacg ccatggctat gcttcaggtg       600
     accaatgaat tcgtcgagat catggacggt gagatggtca tcgtgacccg tgacgacgtg       660
     cagattaaga gcgttgacgg cgacacagtt acccgtgatt cctatattgc agagatcgat       720
     tcaacggata ttgagaaagg cacatacccg cacttcatgc tcaaggagat tgaggagcag       780
     ccgtttacga tgcgaaatat cattacgaaa tataaagatg agaacgagaa cattaagctt       840
     gatgagcata tccggcaggc tgtacttgat gcggaccgta tttacatcat tgcggccgga       900
     acgagcttta atgccggact cgtcggaaaa gaaatgattg aaaagattgc acagatccct       960
     gtggaaacgc atattgccag tgaatttctc tacaatatgc cgatcctcag tcagaaccca      1020
     ctctttattt ttatctcgca gagcggtgaa acagcggact gccgcggtgt gctcgtgaat      1080
     gtgaaggagc ttggtcacaa gaccctgacg attacgaacg tgcctggatc gaccctgtcc      1140
     cgtgaagcgg actataccct gcatacctat gcaggtcctg aaattgccgt cgcctcaacg      1200
     aaggcctata cggcccaaat ggcggtgctt gccattctgt cggtggatac cgcgagagcg      1260
     aaaggcattg agattgactt cgatccgatg caacagctcg gtattgttgc caacgccatg      1320
     gacatcttca tggagaagaa agacgagctt gaacagatgg cccgcgatta tctcagcgtc      1380
     acgcgcaact gcttctacat cggacgcggt atggactatc acgtctgcat ggaagcatcc      1440
     ctgaagctca aggagatttc ctacatccag gcagaaggat ttgccggtgg ggaactgaag      1500
     cacggcacaa ttgcccttat tgaagaaggc actcctgttg tcgggctcgc cacacaggaa      1560
     tcggtacacc tgaatctgcg tggcaatatg aaggaagtcg ttgcccgtgg agcgaacccg      1620
     ctgatgatca gcatggaagg cttcgaagag gcggatgaca agatcgtcat tccgcgcgtg      1680
     cacgagctct tcaccccgct tgtcagcgtc attccgatgc agtttattgc ttattacgca      1740
     gcccttcaca gaggctgcga cgtggataag ccaagaaacc tggcaaaatc cgtcaccgtc      1800
     gagtaa                                                                 1806
//

If you have problems or comments...

PBIL Back to PBIL home page