(data stored in ACNUC7421 zone)

EMBL: CP001791.PE367

CP001791.PE367       Location/Qualifiers
FT   CDS_pept        395830..396801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0379"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sme:SMc01961 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97919"
FT                   /db_xref="GOA:D6XX62"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX62"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADH97919.1"
FT                   /translation="MNEDTKEEINMHRIAGHHHISMITKRAIPNNRFYQEVLGLRRVKV
FT                   TVNQDEPSMYHLFYGDKTGSPGTELSFFEIPKVGRTYRGTNAITRIGLLVPSEASLRYW
FT                   EARFDTHGVTHDGITTYAGHRALPFEDPEGLRLVLLLSNGQKVDHWETWSESDLPDRHQ
FT                   IQGMGSVEMTVRDLDALADTLTGLFGYTEVSRTDQEAVFQSVEGEVFGEIVGVEQDGPA
FT                   EKPGRGSVHHLAIRVQDDEALAYWEEKVREWGFQTAGIVDRYYFKSLYFKETNGIVFEI
FT                   ATDGSGFAIDGNGATLGEQLDLPPFLEGRRKEIERKLTPFFE"
     atgaacgaag atacaaagga ggagatcaat atgcaccgca ttgccggtca tcaccatata        60
     tccatgatta caaaacgcgc tatcccaaat aaccggttct atcaggaggt tctcggcctg       120
     cgccgggtga aagtgaccgt caatcaggat gaaccgtcca tgtaccatct gttttacgga       180
     gacaaaacag ggagtcccgg aacggagctg tccttctttg agattccgaa agtcggacgg       240
     acttaccggg gcacgaatgc gatcacccgc atcggccttc ttgtgccgtc ggaagcgagc       300
     cttcggtatt gggaggcgcg ctttgacacg catggtgtca cccatgacgg catcacaacc       360
     tatgccggac accgggcgct cccttttgaa gatccggaag ggctgcggct cgtcctgctt       420
     ctctccaacg ggcaaaaggt cgaccattgg gaaacctggt ctgagtcgga tttgcccgac       480
     cggcatcaga ttcaggggat gggcagcgtc gagatgaccg tccgggacct ggatgcactc       540
     gcagatacat tgacggggct gtttggttac acagaagtgt cgcgaacaga tcaagaagcg       600
     gtctttcagt ctgtggaagg ggaggttttc ggcgaaattg taggtgtcga acaggacgga       660
     cctgcggaga aaccggggcg ggggagcgtt catcacctcg caattcgggt acaagacgat       720
     gaagcgctgg cgtattggga agaaaaagtc cgggaatggg gctttcagac ggcagggatc       780
     gtcgaccgct actactttaa gagcctgtat ttcaaagaga cgaacggcat cgtctttgaa       840
     atcgccactg atggttccgg ttttgccatt gacgggaatg gtgccaccct tggtgagcag       900
     ctcgatttgc ctcctttcct tgaaggaagg cgaaaagaga ttgaaagaaa actgacgccg       960
     ttttttgagt ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page