(data stored in ACNUC7421 zone)

EMBL: CP001791.PE368

CP001791.PE368       Location/Qualifiers
FT   CDS_pept        396964..397491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97920"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX63"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97920.1"
FT                   /translation="MKRWTLGLFLIALTGCAANAEDPSYVIATLDGETITMEDYFFRYT
FT                   DPSMIEEYLKERVMIKEAEDLGITVSEDEVNASRQMLFPDSDAEERLAFWEDRAFIDEQ
FT                   AERLDMDELAYFKEWEEKMYRSQLFVDAYVEEVFGGFPEDTDEMQALGEEIDAHIDTLF
FT                   DTYQEEYRLEME"
     atgaaacgat ggactttggg cctgttcctc attgcgctca ccggctgtgc ggcgaatgcg        60
     gaggatccat cgtacgtgat tgcgaccctg gacggagaaa ccattaccat ggaggattat       120
     tttttccgtt atacagatcc gtcgatgata gaagaatatc tgaaagaacg ggtcatgata       180
     aaggaagcag aagacctcgg gatcaccgta tcagaggacg aggtgaatgc atcgaggcag       240
     atgctgttcc cggattccga tgcagaagaa cggttggcct tctgggagga ccgggctttc       300
     atcgatgaac aggcagagcg ccttgatatg gatgagcttg cctactttaa ggaatgggaa       360
     gagaaaatgt accggtccca gctgtttgtg gacgcatacg tggaagaggt gttcggcggt       420
     tttcctgagg acacagatga gatgcaagcc ctcggtgagg agatcgacgc acatattgat       480
     acgctttttg atacgtatca ggaagagtac aggcttgaga tggagtag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page