(data stored in ACNUC7421 zone)

EMBL: CP001791.PE371

CP001791.PE371       Location/Qualifiers
FT   CDS_pept        complement(399484..400329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0383"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: dal:Dalk_5022 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97923"
FT                   /db_xref="GOA:D6XX66"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX66"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADH97923.1"
FT                   /translation="MALFLGLITAMAFGIGDFLAGQVTRRVPTLIVVLYAQLFGTVMML
FT                   IVASLTGFHMSLSSFWWGGLGGIAIGFGFLFYFKALAMGKMGVVSSVTGTLSAVVPVLT
FT                   GLFLGERPGTFALVAVGIIMIAIVLISKKEVEGDAEDGDGQKVLSFAAMAGFLIGLYFV
FT                   FLHIPPETESMWTVFFTMAGSFLAVSSVLLFRRADFLTLNRTGLGYIFGNGFLQAFGTI
FT                   TYILGVSIGLLSIVALAGALSPLFTVLCAWLFIKEMLTVPQKWGITLALTGVVLLVLST
FT                   "
     atggctttat ttttgggact cataaccgcg atggcgtttg gcatcgggga ttttctcgcg        60
     ggacaggtga caagacgcgt tccgacactg attgtcgtat tatatgcaca gctcttcggc       120
     acggtgatga tgctcatcgt cgcctctttg accggctttc acatgagcct ttcaagcttt       180
     tggtggggag gactcggcgg catcgccatc ggctttgggt tcctgtttta ctttaaagcg       240
     ctcgccatgg gcaagatggg tgtcgtgtca tcagtgaccg ggactctttc cgctgtggtt       300
     ccggttttga ccggcctctt cttaggggag cggcccggaa cattcgcact cgttgccgtc       360
     ggcatcatta tgattgccat tgtcctgatt tcgaaaaagg aagtggaagg tgacgctgag       420
     gacggtgacg gacagaaggt tctgtcattt gccgccatgg ccggttttct gatcgggctc       480
     tacttcgtat ttctgcatat cccgccggaa acggaaagca tgtggaccgt cttctttacc       540
     atggccggct cttttctagc cgtcagctcc gtgcttctgt tcagacgggc ggactttctg       600
     accctcaacc ggaccggtct cggctacatc ttcggcaacg gttttctgca ggcattcggc       660
     acgatcacct atattctcgg tgtcagcatc gggcttctct ccatcgtcgc cctcgccggc       720
     gccctctccc cgctcttcac cgtgctctgt gcatggcttt tcattaaaga aatgctgaca       780
     gttccacaga aatggggcat cacactcgcc ctgacagggg tcgtcctcct cgtcctgtcg       840
     acgtaa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page