(data stored in ACNUC7421 zone)

EMBL: CP001791.PE375

CP001791.PE375       Location/Qualifiers
FT   CDS_pept        404378..405109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97927"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX70"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97927.1"
FT                   /translation="MAVIWEHKWKILLGVALAITAIIWLLLRSYPAGSLADDAMAGEWS
FT                   DVKDENGAIRFIAEGEPLGHVMYYPGGLVRPESYSYLASQLAEAGVETWVIPMPLNLAV
FT                   LGISRGEQALGLIGGSPVVIGGHSLGGAMAARFAKDHEDQLDGVFFHGAYPDEGGRLDG
FT                   TSLSVLSIQMEEDRVLNSESYEEGLGYMPDAFFEEWIEGGNHASFGDYGPQRGDGEATI
FT                   SHEEAVEQIVDLTVDWLESLQ"
     gtggcagtaa tctgggaaca taaatggaag atccttctcg gtgtcgcctt ggcaattacg        60
     gccatcatct ggctgttatt acggtcttat ccggctggtt cgctcgcaga cgatgcgatg       120
     gcgggcgaat ggagcgatgt gaaagacgag aacggtgcga tccggtttat cgcggaagga       180
     gagccgcttg gtcatgtcat gtattacccg ggcgggctcg tcagaccgga atcttattca       240
     tatcttgcgt cgcaattggc ggaagcaggg gttgaaacct gggtgattcc gatgccgctg       300
     aatctggcgg tacttggcat atcgaggggt gaacaggcgc tgggattgat cgggggaagt       360
     ccggtcgtca tcggtggcca ttctctcggt ggtgccatgg ctgcgaggtt tgccaaggac       420
     catgaggacc aacttgacgg ggtgtttttt cacggggcct atcctgatga gggcggacgc       480
     cttgacggaa cgtctctttc cgtcctttcc attcagatgg aagaggaccg ggtgttaaac       540
     agcgagagct atgaagaagg actcggatat atgcctgatg cctttttcga agagtggatc       600
     gaaggcggca atcatgcttc tttcggtgat tacgggccgc agcggggaga cggggaggcc       660
     acgatcagcc acgaggaagc ggttgaacag attgtggatc tcaccgtgga ttggcttgaa       720
     tcactccaat aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page