(data stored in ACNUC7421 zone)

EMBL: CP001791.PE376

CP001791.PE376       Location/Qualifiers
FT   CDS_pept        complement(405189..406739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0388"
FT                   /product="alkyl hydroperoxide reductase, F subunit"
FT                   /note="KEGG: azo:azo0770 alkyl hydroperoxide reductase
FT                   subunit F; TIGRFAM: alkyl hydroperoxide reductase, F
FT                   subunit; PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; HI0933 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97928"
FT                   /db_xref="GOA:D6XX71"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX71"
FT                   /inference="protein motif:TFAM:TIGR03140"
FT                   /protein_id="ADH97928.1"
FT                   /translation="MVLDNAITQQLKQYLDLLEGDLTFKLDAGSDANSDKLAGFVREVA
FT                   SMSPRITVEEASLARTPSFTVTRTGENTGVTFAGVPLGHEFTSFVLAILQVSGRPPKVE
FT                   EETLNQMKQLEGDFTFETYVSLSCQNCPEVVQALNMLSAVNPGVTNTMIDGAAFKDEVE
FT                   ARDVMAVPAVYLNGEFLGGGRMTIEDILEKLGQGTDASELDAKDPFDVLVVGGGPAGAS
FT                   AAVYASRKGIRTGVVAERFGGQVQDTMSIENFISVKKTEGPKLVASLEEHVRDYSVDIM
FT                   KSQRVKAVDKKDLFEVTLENGAVLKSKSVILSTGARWRNVGVPGEEAFKNNGVAYCPHC
FT                   DGPLFEGKDVSVIGGGNSGVEAAIDLAGIVNHVYLLEFMPELKADEVLQKKLHSLPNVT
FT                   VITNAQTTEITGDKKVNGISYKDRVTEEDRHIPLQGVFVQIGLVPNTEFLDDSIETTRM
FT                   GEIVVDQHGATNVPGLFAAGDCTNTPYKQIIISMGSGATASLGAFDYLIRSEEPVVSV"
     atggtactcg acaacgccat tactcaacag ctgaaacagt atctcgacct cctcgaaggg        60
     gacttgacgt tcaagcttga cgcaggcagc gacgccaatt cagacaaact cgcgggcttt       120
     gtccgtgagg tggcgtcgat gtcgccacgc attaccgtcg aagaagcaag ccttgcgcgt       180
     acgccaagct ttaccgtcac acggacgggc gagaacaccg gcgtcacctt cgccggcgtt       240
     cccctcggac acgagttcac atcgtttgtc cttgcgatcc tccaggtaag cggacggccg       300
     ccgaaagtgg aggaggaaac actcaatcaa atgaaacagc ttgaaggcga ctttacgttt       360
     gagacgtacg tcagcctcag ctgccaaaac tgtccggaag tcgttcaggc tctgaatatg       420
     ctcagtgccg tcaacccagg cgtcacgaac accatgatcg acggcgccgc atttaaagac       480
     gaagtggaag cccgtgacgt catggccgta cccgccgtct atctgaacgg tgaattctta       540
     ggcggcggac gcatgaccat cgaagacatc cttgaaaagc tcggtcaagg gaccgatgcc       600
     tccgaactcg acgcaaaaga tccgttcgat gtcctcgtcg tcggcggcgg tcccgcaggc       660
     gcgagtgcgg ccgtgtacgc ctcaagaaaa gggatccgca ccggagttgt cgccgagcgt       720
     tttggcggac aggtgcagga tacgatgagc atcgagaact tcatcagtgt caaaaagacc       780
     gaaggaccga agcttgtcgc gagccttgaa gagcacgtcc gtgattacag cgtggatatc       840
     atgaagagcc agcgcgtcaa agccgttgat aagaaggatc tctttgaggt cacccttgag       900
     aacggcgcag tccttaaaag caaaagcgtc atcctctcca ccggtgcccg ctggcgaaac       960
     gtcggggttc cgggtgaaga agcattcaaa aataacggtg tcgcttactg cccgcactgt      1020
     gacggcccgc tctttgaagg caaagacgtc tccgtcatcg gcggcggcaa ctcgggtgtg      1080
     gaagccgcca ttgacctggc cgggatcgtc aatcacgtat acctgcttga gttcatgccg      1140
     gaactgaagg ctgatgaagt cctgcaaaag aaactccaca gcctgcctaa tgtcactgtc      1200
     attacgaatg cacagacgac agaaatcaca ggtgataaaa aagtgaacgg catttcctac      1260
     aaagaccgtg tcacagaaga agaccggcac attccccttc agggcgtgtt cgtgcagatc      1320
     ggacttgtgc cgaacaccga gtttctcgat gattccatcg agacgacccg catgggcgaa      1380
     atcgtcgtcg atcagcacgg cgcaaccaac gtcccggggc tgtttgctgc aggagactgc      1440
     accaataccc cctataaaca gatcattatc tcgatgggct ccggagcgac cgcttccctc      1500
     ggcgcgttcg attatttaat ccgctcagag gaacctgtcg tatctgtata a               1551
//

If you have problems or comments...

PBIL Back to PBIL home page