(data stored in ACNUC7421 zone)

EMBL: CP001791.PE378

CP001791.PE378       Location/Qualifiers
FT   CDS_pept        complement(407692..408138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0390"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: dno:DNO_1109
FT                   OsmC-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97930"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX73"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ADH97930.1"
FT                   /translation="MMAKATFKATTQLHEGTKVTAKTRNFTLTIDEPESLGGTDTGMNP
FT                   VEAVLCALGACQAIVARVYAPKFDISFTDLWLDVEGDLDPDGFMNKADVRPGYSEIRYT
FT                   MHIKTDAPKDKVDEFVRFVESKCPVGDSLENNVSMKLADVVIES"
     atgatggcaa aagcaacctt taaagcgacc acccagctcc acgaaggaac caaggtcacg        60
     gccaaaaccc ggaatttcac actgacgatt gatgaaccgg aaagcctcgg cgggacagac       120
     accggcatga accccgttga agccgttctc tgcgccctcg gcgcctgcca ggcaatcgtc       180
     gcgcgggtgt atgcaccgaa gtttgacatc tcgttcaccg acctttggct cgatgtcgag       240
     ggggatcttg atccggacgg attcatgaac aaagccgacg tgcgcccggg ctactctgag       300
     atccgctata cgatgcacat caaaaccgat gccccgaaag acaaggtcga tgagttcgtg       360
     cgctttgtgg aatccaagtg tcccgtcggc gactcccttg aaaacaacgt gtcgatgaag       420
     cttgcggatg tcgtgatcga aagctga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page