(data stored in ACNUC7421 zone)

EMBL: CP001791.PE382

CP001791.PE382       Location/Qualifiers
FT   CDS_pept        410721..412781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0394"
FT                   /product="exporter of the RND superfamily protein-like
FT                   protein"
FT                   /note="KEGG: cja:CJA_3753 putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97934"
FT                   /db_xref="GOA:D6XX77"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX77"
FT                   /inference="protein motif:COG:COG1033"
FT                   /protein_id="ADH97934.1"
FT                   /translation="MQKFTEIITHYHKSVVLVFMALTILSAVMIPFVTVNYNINDYLPE
FT                   DSPSMVAVDVLEEEFGSPMQNARVMIEDVSVQEALTYKDRLEAIEGVSDVTWLDDVVDL
FT                   RTPLELVDEGMLETYYQDRYAIIEMTIQEGEELAITDEIYELIGEENALVGDAIDTAVS
FT                   QQMAFTETLFAALLLVPIIIIILILSTTSWVEPLFFLTAIGVSVLINLGTNIFIGEVSF
FT                   VTNSVAPILQLAVALDYAIFLLHSFSDQRKTDSNPVTAMQKAVRQSFPAIAASAATTFF
FT                   GFMALAVMEFEIGADLGLNLVKGIALSFISVVVFLPALTVWLFKWIDKTQHKPMFPQFR
FT                   NVGKRVVKVRYFSIVLVALIIFPAYLAQQETSFIYGIGEQPEDTRLGADEVKVNEVFGQ
FT                   STPIVLLVPRGDVPRELSLEQDLLAIPEVDSIMSYNELIGSMIPQEHLDESMTEAFLSE
FT                   NYSQLILYTETESEGDEAFAVVEEVKSYAGAYYGDGFHALGESVSLYDIKDIVLDDNRA
FT                   VNIMTVIAIGAVIMVTFRSLLLPVILLVTIQSSVWINLAVPYVTDTPLVYIGYLVVGTV
FT                   QLAATVDYAILFTENFMENRKRMPARAAIIDTVNNKTFSISISAAILSSVGFILFLTST
FT                   NPIIGSIGLLIGRGALLAFLMVLFLLPAILLVGDRLVEKLTYKTDFYKERD"
     gtgcaaaaat tcacggaaat cattacccat tatcataaat cagtcgtcct tgtattcatg        60
     gccctgacca tcctcagtgc cgtgatgatc ccgtttgtga cggtgaacta caacatcaac       120
     gactacctgc ctgaagattc cccgtccatg gtggcggtag atgttcttga agaagaattc       180
     ggcagtccga tgcagaatgc gagagtcatg atcgaagacg tgtccgtgca ggaagccctc       240
     acatacaaag accgcctcga agcgattgag ggcgtgtcgg atgtgacctg gcttgacgac       300
     gtggtggatc ttcggacgcc ccttgaactc gtggatgaag ggatgctcga gacgtattac       360
     caagaccgct atgccatcat cgagatgacg attcaggaag gggaggagct ggcaattaca       420
     gatgagatct acgagctgat cggcgaggag aatgccctcg tcggcgatgc gattgatacg       480
     gccgtgtcgc agcagatggc gtttacggag acgctgttcg cggccctcct gctcgtgccg       540
     attatcatca ttatcctcat cctctcaacg acttcctggg tggagccgct gtttttcctg       600
     acagcgatcg gggtgtcggt gctgatcaat ctcgggacga acatcttcat cggagaagtc       660
     tccttcgtca ccaattccgt cgcgccgatc ctgcagctcg ccgtcgctct cgactatgcg       720
     atctttttgc tccacagctt cagcgatcaa aggaagacgg attccaatcc ggtgacggcg       780
     atgcaaaagg cagtacgcca gtcgtttccg gcgattgcgg ccagtgcagc aacgacgttc       840
     ttcggcttta tggcccttgc ggtcatggag tttgagatcg gggcagatct tggtctgaac       900
     cttgtcaaag gcatcgcgct aagcttcatc agcgtcgtcg tgttcctgcc ggctctgacg       960
     gtctggctgt tcaaatggat cgacaagacc cagcataagc cgatgttccc gcagtttcga      1020
     aacgtcggca agcgtgtggt caaagtccgt tatttctcga tcgtcctcgt ggccctgatc      1080
     attttccctg cgtatctcgc ccagcaggag acgagcttta tctacggcat aggcgagcag      1140
     cctgaggaca cgcgcctcgg agcggatgag gtgaaagtca acgaggtctt cggacagtcg      1200
     acgccgatcg tgcttctcgt gccgagagga gacgtgcccc gggagctgtc ccttgaacag      1260
     gatctgttgg ccatcccgga agtcgacagc atcatgtcct acaatgagct gatcggttcg      1320
     atgattcctc aggaacatct tgatgaatcg atgacagagg cttttctctc tgagaactac      1380
     agtcagctca tcctctatac ggaaacggaa tccgaagggg acgaggcctt tgctgtagtg      1440
     gaagaagtca aatcgtatgc cggggcctat tacggggacg gcttccatgc cctcggggag      1500
     agtgtctccc tctacgacat taaagacatc gtcctggacg ataaccgggc tgtaaacatc      1560
     atgacggtca ttgccatcgg tgccgtgatc atggtgacgt tccggtccct tttgcttccg      1620
     gtgattctgc ttgtgacgat ccagtcgtcg gtatggatca acctggccgt gccgtatgtg      1680
     acagacacac cgctcgtcta tatcggctat ctggttgtcg gaaccgtgca gcttgcggcg      1740
     acggtggact atgcgatcct gttcaccgag aatttcatgg agaaccgcaa gcggatgccg      1800
     gcgcgtgcgg caatcatcga taccgtcaac aacaagacgt tctccatctc gatctcggcg      1860
     gcgattctgt cgagtgtcgg atttatcctg tttctcacct cgacgaatcc gatcatcgga      1920
     tccatcggac ttctcatcgg acggggcgcc ctgctggctt tcctcatggt cctgttcctg      1980
     cttccggcga ttcttcttgt cggagacagg cttgttgaga aactgacgta taagacggat      2040
     ttctataagg agcgtgactg a                                                2061
//

If you have problems or comments...

PBIL Back to PBIL home page