(data stored in ACNUC7421 zone)

EMBL: CP001791.PE383

CP001791.PE383       Location/Qualifiers
FT   CDS_pept        412784..414625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0395"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: Axoneme-associated protein GASP-180"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97935"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX78"
FT                   /inference="protein motif:COG:COG1511"
FT                   /protein_id="ADH97935.1"
FT                   /translation="MNKWTAGLLAALILPPVYIGFADDTAHDNETPETSGTDGEVASKE
FT                   EVIYGNLNHDGSVTDLYVVNMLDVTSAGRIVDYGNYDSVQNLTSLAEIQIDGDEISAEA
FT                   EEGWFYYQGNKDGATLPWAMDITYTLDGEEVDAGDLAGADGHLHLSLTTEANDGVNPSF
FT                   YENYTLQVSVSFDASVAGNIHAPDATVANAGKERQLSYTVMPETDGDIEFFADVTDFEM
FT                   NGIEIAAIPMTLAMEDPDTGEMVSELRDLSDGIAEIHDGVGELNDGVFELVDGLWTLTD
FT                   GSSDFLSGLREVDGSSGDLVHGSREIRDGLAQLDRELDVSEFDMDVDLNGFDELTKGLH
FT                   ELSGGLEELSGGLGLLGDQYEEARKALDEAVKAIPEEVPSEEAIKALYMTTEDHETLDS
FT                   LVDQYAAAQRVKQTYDAVSGAFDAVTGTLGEAVKGLDESVTGLRTMASELEASLASFED
FT                   LEDPEALEGLRELERGIGELSSNYHAFHDGLVSYTGGVGELAGNYRDLDDGVSEAADGT
FT                   RELGDGTDELYDGTGELEENTRDLPDQIQDEVDELMAEYDKSDYEPVSFVSERNEQVSV
FT                   VQFVLRTDAIELPDDEDGELAEEDEENWFDRIMNLFS"
     atgaacaaat ggacagcagg tctcctcgca gccctgattc tgcctccggt gtacatcgga        60
     tttgccgatg acacggcaca tgataatgaa acgcctgaga catccggcac cgacggtgaa       120
     gtggcttcca aagaagaagt catctacggc aacctgaatc atgacggctc cgtgacggac       180
     ctttatgtgg tcaatatgct cgacgtgaca agcgcggggc gaattgtgga ttacggcaat       240
     tatgacagtg tgcagaacct gacgagcctg gctgaaatcc aaatcgacgg agacgagatc       300
     tctgccgaag cggaagaggg ctggttttat taccagggca ataaggacgg tgccacgctc       360
     ccctgggcca tggacatcac ctataccctt gacggggaag aggtggatgc cggtgatctt       420
     gccggtgccg acgggcatct gcatctgagc ttgacgaccg aagccaatga cggggtgaat       480
     ccgtcgtttt atgagaacta taccttgcag gtatcggtga gctttgacgc ctccgtcgca       540
     gggaatatcc acgcgccgga tgcgaccgtg gccaatgcgg gcaaggagcg tcagctgtcc       600
     tatacggtca tgcccgaaac ggacggggac atagagtttt ttgccgatgt gacggatttc       660
     gagatgaacg gcatcgagat cgccgcgatt ccgatgaccc tcgccatgga agacccggat       720
     accggggaga tggtctcgga gcttcgggat ctgagtgacg gtattgccga gattcatgat       780
     ggcgtcggtg agctgaatga cggtgtcttt gagctcgttg acggactgtg gacgctgacg       840
     gacgggtctt ccgacttcct ctcaggactg cgtgaagtgg acggctcctc cggagatctc       900
     gttcacggtt cgagagagat ccgggacgga ctcgcgcaac ttgaccggga gctcgatgta       960
     tccgagtttg atatggacgt cgacttgaac ggttttgatg agctgacgaa aggccttcac      1020
     gagctgtccg ggggacttga agaactctcc ggcgggcttg gtttactggg tgaccaatat      1080
     gaagaagcga gaaaggccct cgatgaggca gtgaaggcca ttcctgaaga ggtgccttct      1140
     gaagaggcca tcaaggcgct gtacatgacg acagaggatc atgagacgct cgacagcctc      1200
     gtggatcagt acgccgctgc gcagcgggtc aaacagacgt acgacgcagt cagtggagca      1260
     tttgatgccg tgacgggcac cctcggtgaa gccgtcaaag gtcttgatga gtcggtgaca      1320
     ggtcttcgca cgatggcttc tgaactcgag gcgtcgctcg cgtcctttga agacctcgaa      1380
     gacccggaag cccttgaagg tctccgtgag cttgaacggg gcatcgggga actgtcgtca      1440
     aactaccacg cctttcatga cggactcgtg tcgtataccg gaggcgtcgg tgagctcgcc      1500
     ggcaactacc gtgatctcga tgacggcgtc agtgaggccg cagatggaac acgtgagctc      1560
     ggtgacggga ccgatgaact gtatgacggg acaggtgaac ttgaagaaaa cacccgggat      1620
     ctcccggatc agattcagga cgaagtggat gaattgatgg cggagtatga caagtccgac      1680
     tacgagcctg tttcgtttgt gtcagagcga aacgagcagg tgtcggtcgt gcagttcgtc      1740
     cttcgcacag atgcgataga acttcctgac gatgaagacg gggagcttgc agaggaagac      1800
     gaagagaact ggttcgaccg gattatgaac ctgttctcct ga                         1842
//

If you have problems or comments...

PBIL Back to PBIL home page