(data stored in ACNUC7421 zone)

EMBL: CP001791.PE385

CP001791.PE385       Location/Qualifiers
FT   CDS_pept        complement(415281..416096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0397"
FT                   /product="Aminoglycoside N(3')-acetyltransferase"
FT                   /EC_number="2.3.1.81"
FT                   /note="KEGG: hypothetical protein; PFAM: aminoglycoside
FT                   3-N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97937"
FT                   /db_xref="GOA:D6XX80"
FT                   /db_xref="InterPro:IPR003679"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX80"
FT                   /inference="protein motif:PRIAM:2.3.1.81"
FT                   /protein_id="ADH97937.1"
FT                   /translation="MTNEIHASTVLNTVDTLTRDLKINGIEEGDLLLVHASLSALGWVN
FT                   GGSAAVIGALITAIGPDGTIVMPAQSGDLSDPSEWEAPAVPQAWWQTIRDTMPAYDPAI
FT                   TQTRGIGTIAEHFRTWPGTDRSLHPALSFSARGPLARTVLHPHPLACGLGEDSPLGRLY
FT                   EHGAKVLFIGNGYDANTCFHLGEYIAPSPPMIEKGAPVLTDGVRQWITYEEVDLDEEVF
FT                   EEIGRTFEETYPVHTGKIGDATAKVFALRDAVDASTTWFTAHRQTQTAD"
     gtgacgaatg aaatccatgc ttccaccgta ttgaataccg ttgataccct gacacgcgac        60
     ctcaaaataa acggcatcga agagggagac ctcctcctcg ttcacgcctc cctgtctgcc       120
     ttaggctggg tgaacggcgg gagtgccgcc gtcatcgggg ccctgatcac agccataggg       180
     cctgacggaa ccatcgtcat gcctgcacag agcggtgacc tgagtgatcc gtccgaatgg       240
     gaggcgccgg ctgtcccgca agcctggtgg cagacgatcc gggacacgat gcctgcctat       300
     gacccggcca tcacacagac ccgggggatc ggcaccatcg ccgaacactt ccgcacatgg       360
     cccggcactg accggagcct gcacccggcc ctctcttttt cggcgcgggg acctctcgca       420
     aggaccgtgc ttcatccgca tcctcttgcc tgcggtctcg gtgaggactc gccccttggc       480
     cggctctatg agcatggcgc caaagtgctc tttatcggca acggctacga cgccaacacg       540
     tgctttcacc tcggtgaata cattgccccg tccccgccga tgatcgaaaa gggcgcaccg       600
     gtcctcacag acggtgtcag gcagtggatc acgtacgaag aggtcgacct cgatgaagag       660
     gtgtttgaag agatcggccg cacctttgaa gagacgtacc ccgtccatac cggtaagatc       720
     ggcgatgcca cggcgaaagt cttcgctctt cgcgatgcgg tggacgcttc caccacctgg       780
     ttcacggcac accgacagac ccaaaccgca gactga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page