(data stored in ACNUC7421 zone)

EMBL: CP001791.PE386

CP001791.PE386       Location/Qualifiers
FT   CDS_pept        complement(416103..416786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0398"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159; KEGG:
FT                   ppd:Ppro_0189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97938"
FT                   /db_xref="GOA:D6XX81"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX81"
FT                   /inference="protein motif:PFAM:PF02586"
FT                   /protein_id="ADH97938.1"
FT                   /translation="MCGRFSLYHQPNLIARRFELDNLEAIALDPRYNIAPSQDILAIVH
FT                   DGKTNRAGFLRWGLIPSFAKDPKIGSKMINARAETLYEKPSFAKLLTRRRCIIPANGFF
FT                   EWQKTETGKVPMHIQLRDGEPFAMAGLWDRWQDEGGETITSCTIITTEPNTLMAPIHNR
FT                   MPAILTRDQEAIWLDRRETGTDRLKSLLTPFDSRQMTATAVSSLVNSPKHDSPTCIAPI
FT                   PNETE"
     atgtgcggcc gattcagctt gtatcatcag ccaaacctga ttgcacgcag gtttgagctt        60
     gacaatcttg aagccatcgc ccttgatccg aggtataaca tcgcgccctc ccaggacatt       120
     ctcgccattg ttcatgatgg aaaaacgaac cgggccggtt tccttcgttg gggcctgatc       180
     ccctcgtttg caaaagaccc caagatcggg tctaagatga tcaacgcacg ggccgagacc       240
     ctttacgaga agccgtcgtt tgcgaagctt ctgacacgca ggcgctgcat catccctgcg       300
     aacgggtttt ttgaatggca aaaaactgaa accggaaaag ttcccatgca tatccaactc       360
     agagacgggg aaccgttcgc catggccggg ctttgggacc gctggcagga tgaaggaggg       420
     gaaacgatca cgagctgtac gatcatcacc acggaaccga atacgctcat ggccccgatc       480
     cataaccgga tgccggccat cctgacaagg gatcaggaag ccatctggct tgaccggcgc       540
     gaaacaggga cggacaggct gaagtcgctt cttacccctt ttgacagccg gcagatgact       600
     gcgacggccg tatcgagtct cgtcaactca ccgaaacacg actcaccgac atgcatcgca       660
     cccataccga acgaaacgga gtga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page