(data stored in ACNUC7421 zone)

EMBL: CP001791.PE387

CP001791.PE387       Location/Qualifiers
FT   CDS_pept        416939..417958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_4664 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97939"
FT                   /db_xref="InterPro:IPR021243"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX82"
FT                   /inference="similar to AA sequence:KEGG:PSPA7_4664"
FT                   /protein_id="ADH97939.1"
FT                   /translation="MQAMELTKPVRLSLNDGTLNPESAGWARHPIVTSNLSGASMRKKK
FT                   WNYWCITSDDILFSATISHIDYAASLFVYLYDRHTGEFVEKTVTVPFGIGVRMPEEVRA
FT                   PLFVDRSGFTIRFLEKPDATELFVNIRDFGGKPLDAYVEIARPKGYESLNVVIPWSESH
FT                   YQYTSKQPALPAFGTVEWGGYRHHLDKRNQSFACLDFGRGKWPYRSSWNWGSASGRDKD
FT                   GRVIGLNLGGKWTDGTGQNENGIVVDGVLCKIHEDLDWDYDPSDLMRPWTIRDKGNETV
FT                   TLTFYPSFERLAETNLGVIQSKVHQMFGHYEGTVMTDGAGTVQISDLFGWAEDHHAKW"
     atgcaggcaa tggaactgac gaaacccgta aggctgagtc tgaacgatgg gacgctgaat        60
     ccggaaagtg cgggctgggc gaggcacccg attgtcacat ccaatctgag cggtgcaagt       120
     atgcgtaaga agaagtggaa ctactggtgt atcacgagtg atgacatcct gttttcggcg       180
     acgatcagcc acattgacta tgcggcaagt ctgttcgtct atctgtacga ccgtcatacc       240
     ggagaattcg tggaaaagac ggtcaccgtg ccgttcggga tcggggtgcg gatgcccgaa       300
     gaggtgaggg cgcccctttt tgtggatcgg agcgggttta cgatccgctt tctggagaaa       360
     ccggatgcga cggagctgtt tgtgaacatt cgggatttcg gcggaaagcc gctggatgcc       420
     tacgtggaga ttgcccgtcc gaaagggtat gaatcattga atgtcgtcat tccctggagt       480
     gaaagccatt atcagtatac gtccaagcag ccggcactgc cagcattcgg aacggtggaa       540
     tggggcggat accggcacca tttggataag cggaatcaga gcttcgcgtg tctcgacttc       600
     ggccgcggca agtggccgta ccgctcatcc tggaattggg gcagtgcttc gggacgtgat       660
     aaggacgggc gcgtcattgg actgaacctc ggcggtaaat ggacggacgg taccgggcag       720
     aacgaaaacg ggattgtcgt ggacggtgtt ctctgcaaga ttcatgagga tctcgattgg       780
     gactatgatc cgtctgatct gatgcggcct tggacgatca gagataaggg gaatgagacg       840
     gttactctga cgttttatcc gtcgtttgaa cggctcgccg agaccaatct cggggtcatt       900
     cagtcgaagg ttcaccagat gttcggtcat tatgagggaa cggttatgac tgacggagcc       960
     gggacggttc agatcagtga cctcttcggc tgggcggagg atcatcacgc gaaatggtag      1020
//

If you have problems or comments...

PBIL Back to PBIL home page