(data stored in ACNUC7421 zone)

EMBL: CP001791.PE388

CP001791.PE388       Location/Qualifiers
FT   CDS_pept        complement(418008..420221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97940"
FT                   /db_xref="GOA:D6XX83"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX83"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97940.1"
FT                   /translation="MTIRLKVKHLVYSLLAFLALFAVVLLVFEPKLHEWQIDRQIASGQ
FT                   EDGAREQILDRIVRNQTASTGLIETYMITPLSEDASSLTISPASTSWSTSDTPVLFTLE
FT                   EAAPYLKTYLEEGEDTIHLLSAADLLMRHDQTNGDPEGVLETMETASERQTAYPAHQTD
FT                   LTFDAIGILIEMNEHELARSILNACEDTFDSGDAALRSAILHARMDLYEEDYEEAHALL
FT                   QDAMERYEAHHDEQETAHAESQNGYEPFNLDQAVYFQEAKRLHERLEPLEEGRHNGTVE
FT                   GRVTGADGEPLAHTRVFLQEDAQRDRSLNRESALATKTDGDGYYRFDGVIPDDYLPFVM
FT                   LSMDEVSGSAWPVDANEVIRVEDGDTATYDITFTPLIEQHEPINHDEITDDTITFSWED
FT                   VDGAAFYSLELTVHHDGGSMTQSVETDITSNRHTIETDALYDRTFGVMSDPEDDELIQP
FT                   ETILAFSYPDGEFSWNVRAFDEDRSPIAQSNGYRLDEDAMGQLPFFRLDTRTLTNADRR
FT                   LLDEDVPGALEAYRNAYADDPEDAHSLRMLTRLNGFSESRAEETMMYRRQLHDVAPSIA
FT                   NVSELLRHTMREGDLTEASRWKEAYLDLLEEDEPNELENGRFALINAFEGEFDQAQERL
FT                   AQSVDADSYNRFSGARAVVALASGQGLDEALAIVRQNPERTRSNLAAENWERHLEHLEG
FT                   MEEDFLQEAAQAMLTRDQDAIDVLTDEHPSLSSLTDAWQDRDW"
     atgaccatcc gtttgaaagt caaacacctc gtatacagcc tgcttgcatt tttggccctc        60
     tttgccgtcg tgttactcgt ctttgaaccg aagcttcacg aatggcaaat cgacaggcaa       120
     attgcctcgg gacaagaaga cggagcaaga gaacagattc ttgaccggat tgtacgcaat       180
     cagacggcga gcaccggtct gattgaaacg tacatgatca caccactcag tgaggatgcg       240
     tcgagtctca cgatcagccc ggcatcaacg tcctggagca cgtccgacac tcccgtgctc       300
     ttcacccttg aagaagcggc accgtatttg aagacgtatc ttgaggaagg agaggacacg       360
     atccatctgt tatcggcagc ggatcttctc atgaggcatg atcagacaaa cggcgatcct       420
     gaaggtgtcc tcgaaacgat ggagacagcc tccgagcgtc agacagctta tcccgctcat       480
     cagacagatc tcacattcga tgccattggc atactgatcg aaatgaacga gcatgagctt       540
     gcccgttcga tcctgaatgc ctgtgaagac acgtttgaca gcggcgatgc cgccctgcgg       600
     tccgccattc ttcacgcacg tatggatctg tatgaggagg actacgaaga agcccacgcg       660
     ctcctgcaag atgccatgga gcgctatgaa gcccatcatg atgaacagga aacagcccat       720
     gcagagagcc aaaacggcta tgagcccttc aatctcgacc aagccgtcta tttccaggaa       780
     gcgaaacggc tgcacgagcg gctggagccc ctcgaagagg gtcgtcacaa cggcacggtt       840
     gaaggacggg tgaccggcgc tgacggggag cctctcgccc atacccgggt ctttctgcag       900
     gaagacgcac agcgcgaccg gtcactgaac cgggaatccg ccctggccac gaagaccgat       960
     ggcgacggct attaccgctt cgacggcgtt atcccggatg actacctccc gtttgtgatg      1020
     ctgtcgatgg atgaagtgag cggatcggcc tggcccgttg acgccaatga ggtgattcgg      1080
     gtggaagacg gtgatacggc gacgtatgac atcacgttca cacctctgat cgagcagcat      1140
     gaaccgatca atcatgacga gatcacggat gatacgatca ccttttcatg ggaagatgtg      1200
     gacggcgccg ccttttactc gctcgagctg acggtccatc acgacggcgg ttcgatgacg      1260
     cagagcgtgg agaccgacat cacatcaaac cggcatacaa tcgagacaga tgcgctctat      1320
     gaccggacgt ttggggtgat gtctgacccc gaagacgacg aactcatcca gcccgagacc      1380
     atcctcgcct tcagctaccc ggacggggaa ttctcctgga acgtcagggc cttcgatgaa      1440
     gaccgctccc cgatcgcaca gagtaacggc taccgtctcg acgaggatgc catggggcaa      1500
     ctgccctttt tccgccttga tacacggaca ttgacaaacg cagaccgccg cctccttgac      1560
     gaggacgtgc ccggtgccct cgaagcctac cggaacgcct atgccgatga tccggaggac      1620
     gctcacagct taaggatgct gacaagactg aacggcttca gcgaatcccg tgcggaagaa      1680
     acgatgatgt accgcaggca gctccatgac gttgccccat ccatcgccaa cgtctccgaa      1740
     cttctccggc atacgatgcg cgagggagac ttgacggaag cgtcccgttg gaaagaggcg      1800
     tacctggacc tcttggaaga ggatgaacca aacgaacttg aaaacggccg cttcgcactc      1860
     atcaacgcct ttgaaggcga gttcgatcag gcacaggaac gtctcgctca gtctgtcgac      1920
     gcagactcat acaaccgctt ttccggcgcc agggccgtcg tcgccctcgc ctctggtcag      1980
     gggctcgatg aagcccttgc gattgtccgt cagaatccgg agcgaacgcg ttcgaatctc      2040
     gcagccgaaa actgggaacg ccatctcgaa caccttgaag gcatggaaga agacttcctg      2100
     caagaagccg ctcaggcaat gctcactcgc gatcaggacg ccatagacgt tctgacagac      2160
     gagcatccgt cgctgtcatc tctgaccgac gcctggcagg atcgcgactg gtga            2214
//

If you have problems or comments...

PBIL Back to PBIL home page