(data stored in ACNUC7421 zone)

EMBL: CP001791.PE389

CP001791.PE389       Location/Qualifiers
FT   CDS_pept        complement(420218..420523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97941"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX84"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97941.1"
FT                   /translation="MMNDDQKPAVRQALDRELQHETFHGHDAVLKRTHPVTWKDRLANV
FT                   WNKEVRIPVVPLGAALFLLITSGTTIAVPGDEPERELIERGGSYYWHDLFEEEDSS"
     atgatgaacg acgatcagaa accggcagtc agacaggcac tcgatcgcga acttcaacat        60
     gagacgtttc acggacacga tgccgttctg aagaggaccc atccggtaac ctggaaagac       120
     cggcttgcaa acgtttggaa caaagaagtc cggatcccgg tcgttcctct cggcgctgca       180
     ttgtttcttc tgatcacctc aggcacgacc attgctgttc ccggagatga accggagcgt       240
     gaactcatcg aacgcggggg cagctattat tggcatgacc tgtttgaaga ggaggattca       300
     tcatga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page