(data stored in ACNUC7421 zone)

EMBL: CP001791.PE39

CP001791.PE39        Location/Qualifiers
FT   CDS_pept        49292..49573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0040"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /note="KEGG: shm:Shewmr7_0131 excinuclease ABC subunit C;
FT                   PFAM: Excinuclease ABC C subunit domain protein; SMART:
FT                   Excinuclease ABC C subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97591"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV33"
FT                   /inference="protein motif:PFAM:PF01541"
FT                   /protein_id="ADH97591.1"
FT                   /translation="MSPVNHYVYMLRCKDNTLYTGYTTDPKRRLSMHETGKGARYTKGR
FT                   GPFVLEHLECYGTKGEAMSREHAIKALTRRQKEALIKAGKMTEMRDQG"
     atgtctccag ttaaccatta cgtctatatg ctccgctgca aagacaacac cctctatacc        60
     ggctatacaa ccgatccaaa gcgcaggctt tcgatgcacg agacgggcaa gggggcgcgg       120
     tatacaaaag ggagaggacc gtttgtcctt gaacacctgg agtgttacgg gacaaaaggc       180
     gaggcgatga gccgggaaca cgcgatcaaa gcactgaccc gcaggcagaa agaggcgtta       240
     atcaaagcag gaaaaatgac ggaaatgagg gatcaagggt ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page