(data stored in ACNUC7421 zone)

EMBL: CP001791.PE392

CP001791.PE392       Location/Qualifiers
FT   CDS_pept        422534..423802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0404"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; KEGG: neu:NE2190 integron/retron-type RNA-directed
FT                   DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97944"
FT                   /db_xref="GOA:D6XX87"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX87"
FT                   /inference="protein motif:PFAM:PF00078"
FT                   /protein_id="ADH97944.1"
FT                   /translation="MQLIDRVVCPDNLNLAMNRVISNKGNPGVDGMTVDQLEAHVRQYA
FT                   KPLIAKIQKGTYQPLPVKRVEIPKENGKKRKLGIPAVRDRMVQQAIFQVIEPIIDPHFS
FT                   PNSYGFRPGKNAKQAIKQAAKYYDEGFKMVVDIDLKSYFDTIPHQKLMNYLEQYIQDPI
FT                   ILKLIWKFLKSGIMIGDNWESSRNGAPQGGNLSPILSNVYLHELDKELERRGHRFVRYA
FT                   DDFCIYVKSRRAAERVLLNTTTFLEGTLKLSVNQEKSAIGSPTKRKFLGFCIHKSNNET
FT                   RCRPHHAFKAKFKAKLKYLTRRNQANSFDYIILKINQVTTGWINYYGISYMKSFINSIK
FT                   QWLHHRLRQLIWKQWKKIKTRYKNLMKYGIETEEAWKMANTRKGYWRASKNETLHKAIK
FT                   IEKLAGWGLKDMSQLYERAYSTY"
     atgcaattaa ttgacagagt ggtctgtccg gataacctga atttggcgat gaaccgggtg        60
     atttccaata aaggaaaccc cggggtcgac gggatgaccg ttgaccaact tgaagcacat       120
     gttcgccaat atgcgaaacc attgatagcc aaaatccaaa aagggacata tcaaccttta       180
     cccgtaaaac gggtagagat tccgaaagag aatggaaaga aacgcaaatt ggggataccg       240
     gcagtccggg accgtatggt ccagcaagcg atttttcaag ttattgaacc gataatagat       300
     ccgcacttct ctccaaacag ttatgggttc agaccgggta aaaatgccaa acaagcgatt       360
     aaacaagccg caaaatatta tgatgaagga ttcaaaatgg tcgtggatat cgatctgaaa       420
     agttattttg atacgattcc ccatcaaaag ctgatgaact atcttgaaca atatattcag       480
     gatccgatca tcttgaaact gatctggaag tttcttaaaa gcgggattat gataggggac       540
     aactgggaat cttcaagaaa cggtgcaccg caaggtggca acttatcacc gattctcagc       600
     aatgtttacc tacatgaact ggataaggaa ttggaaagaa gaggccaccg tttcgtcaga       660
     tatgcagatg acttttgcat ctacgttaaa agtcgcagag ctgcggagcg tgtgctcctt       720
     aacacaacaa ctttcctcga gggaacactt aaactgagtg tgaaccaaga gaaaagtgct       780
     ataggatcac caacgaaacg aaagtttctg gggttttgca ttcacaaaag taataacgaa       840
     accaggtgca gacctcacca cgccttcaag gcgaagttca aagccaaact gaaatatctg       900
     acgagaagaa accaggcgaa ctccttcgat tacattattc ttaagattaa ccaggtgaca       960
     accggctgga tcaactacta tggcatcagt tacatgaaat cctttatcaa cagcattaag      1020
     caatggttac accatcggct gaggcaactg atctggaaac agtggaagaa aattaaaacg      1080
     agatacaaga atttgatgaa gtatggcatt gaaaccgaag aagcttggaa aatggcaaac      1140
     actcgcaaag gctattggcg tgcctccaag aacgagacac tgcacaaagc catcaaaata      1200
     gaaaagctcg cagggtgggg actcaaagac atgagtcaac tctacgagcg tgcatactca      1260
     acttattga                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page