(data stored in ACNUC7421 zone)

EMBL: CP001791.PE395

CP001791.PE395       Location/Qualifiers
FT   CDS_pept        complement(426338..426862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0407"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   kpn:KPN_pKPN3p05928 N-acetyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97947"
FT                   /db_xref="GOA:D6XX90"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX90"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH97947.1"
FT                   /translation="MTDILIRPMTVQEWPAVSAIYQAGLDTELATFETVVPSWDSWNQA
FT                   HHETCRLIAEYGGTIAGWAALAPTSPRYAYRGVAEISIYIAPGASGLGVGRTLLNALIE
FT                   DSEKAGFWTIQSAIFRENQASIHLHKKCGFRQIGYREQVAERHGVWHDIILMERRSPIV
FT                   AASPSARPDPS"
     atgacagaca ttcttatccg ccccatgacc gttcaggaat ggcctgcagt aagcgccatt        60
     tatcaagccg gtcttgatac ggagcttgcc acattcgaaa ccgtcgtccc atcatgggac       120
     tcctggaatc aggcccatca cgaaacatgc cgtctcatcg ccgagtatgg cggcacgatt       180
     gccggctggg ccgccctggc accgacgtcc ccgcgctacg cttaccgggg cgtcgcagaa       240
     atcagcatct acattgcccc cggcgcctcg ggcctgggcg ttggccgcac gctcctgaat       300
     gcccttatcg aagacagtga aaaagccgga ttctggacga tccaatcagc gatcttccgg       360
     gagaatcagg cgagcattca cctgcataag aaatgcggtt tccggcagat cggctaccgg       420
     gaacaggtcg ccgaacgcca cggcgtctgg cacgacatta ttctcatgga gagacggagc       480
     cctattgtgg cagcctcccc gtcagcacga ccagatccat cgtaa                       525
//

If you have problems or comments...

PBIL Back to PBIL home page