(data stored in ACNUC7421 zone)

EMBL: CP001791.PE398

CP001791.PE398       Location/Qualifiers
FT   CDS_pept        complement(430946..431500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0411"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: gbm:Gbem_2479 LemA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97950"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX93"
FT                   /inference="protein motif:PFAM:PF04011"
FT                   /protein_id="ADH97950.1"
FT                   /translation="MIGLLIILAIVVIFVLAWVSAYNGLIKMRNWVEESWAQIDVQLKR
FT                   RYDLIPNLVETVKGYAKHEEETLTKVVELRNKMGDSTLSRQDTMEVNDQLSGALKSMFA
FT                   LREAYPDLKANENFKMLQEELTQTENKIAYSRQLYNNTVMKYNTKIESIPTNIIAGIHN
FT                   FEKRDMLEAKAEERENVRVSF"
     atgatcggat tacttattat acttgccatt gtcgtgattt tcgtacttgc atgggtctcc        60
     gcctacaacg gcctgatcaa aatgcgcaac tgggtggagg agtcctgggc tcagattgac       120
     gtccagttaa aacgccgcta cgaccttatt ccaaacctgg tggaaaccgt gaaaggttac       180
     gccaaacacg aggaggagac attaacgaaa gtcgtcgaac tccggaacaa aatgggggac       240
     agcaccttaa gccgccagga taccatggaa gtgaacgacc agctgagcgg tgcgcttaag       300
     agcatgttcg cacttcgtga agcctaccct gacctgaaag ccaatgagaa cttcaaaatg       360
     ctgcaggaag aactgacaca gaccgaaaac aaaattgcct attcaagaca gctttacaac       420
     aacaccgtca tgaaatacaa cacgaaaatc gaatccatcc caacaaacat cattgccggg       480
     atccacaact tcgaaaagcg cgatatgctc gaagcaaaag cggaagaacg ggaaaatgtc       540
     cgggtatcct tttaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page