(data stored in ACNUC7421 zone)

EMBL: CP001791.PE401

CP001791.PE401       Location/Qualifiers
FT   CDS_pept        434561..435463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0414"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pct:PC1_0737
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97953"
FT                   /db_xref="GOA:D6XX96"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX96"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97953.1"
FT                   /translation="MAKLQDGTPVGSKRKIVTPKTAPYFFIAPAVLLFLAFTLYPVIQS
FT                   LILSFQTSSAGVTSFAGLDNYRRLFNDPLFFTALGNTFTILIIQVPIMLSIAVVLAVLM
FT                   NSALLKMRAFFRIAFFMPAITALVAYAIVFMILLDQNYGLVNYVLGLIGIDNVPWLNDP
FT                   FWAKVALIVAITWRWTGYNMVIFLAGLQNISSDLYEAASIDGAGKIRQFFSITLPQLKP
FT                   IFLFTAVLSTIGTLQLFDEPFILTNGGPNNATLTISLYLYLNGFRYFDFNYASAIAYVL
FT                   VIIIAALSYLQMKVAGDDE"
     atggcgaaat tacaagacgg aacaccagtg gggagtaaac gaaagattgt gacaccgaaa        60
     acagcgcctt acttctttat tgccccggct gttctgttgt ttctcgcatt tacgttatat       120
     ccggttattc agtccctgat tctcagtttc cagacttcat ccgcgggcgt tacctcgttt       180
     gccggtttgg ataactaccg gaggttgttt aacgatccgc tctttttcac ggcgctaggc       240
     aataccttca cgattttgat cattcaggtg ccaatcatgc tctcgatcgc ggtggtactg       300
     gctgttctga tgaactcggc gctgcttaaa atgagagcat tcttcagaat cgccttcttt       360
     atgccggcga ttacggcgct cgttgcgtat gccattgtgt ttatgatcct gctcgatcag       420
     aactacgggc ttgtgaacta cgtgctcggg ctcatcggca ttgacaatgt accctggctg       480
     aacgatccgt tctgggcaaa agtagcgctg atcgtcgcga ttacctggcg ctggacggga       540
     tataatatgg tgattttcct tgccggcctg cagaatatct ccagcgatct gtacgaagcg       600
     gcaagcattg acggggcggg gaagatccgg cagttcttca gcatcacgct cccgcagttg       660
     aagccgatct ttctttttac ggcagtgctt tccacgatcg gcacgcttca gctgtttgat       720
     gagccgttca ttttgacgaa cggcggaccg aacaacgcga cactcacgat ctctttgtat       780
     ctgtatttaa acggtttccg ctattttgat tttaactatg cgtcggcgat tgcctacgtt       840
     ctggtcatta tcattgcggc gctgtcctat cttcaaatga aagtcgcagg tgatgacgaa       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page