(data stored in ACNUC7421 zone)

EMBL: CP001791.PE404

CP001791.PE404       Location/Qualifiers
FT   CDS_pept        439554..440594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0417"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: vfm:VFMJ11_A0386 DNA-binding transcriptional
FT                   repressor EbgR; PFAM: regulatory protein LacI; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97956"
FT                   /db_xref="GOA:D6XX99"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX99"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADH97956.1"
FT                   /translation="MATMKDIAEKSGYSIATVSRVLNQDASLAVTDATKEKIFQVAQSL
FT                   GYKTLRDKRSEKEAQDPSRLTMGLVYYRTEEQELSDPYFLSIRLGVENKCARMGVTLEK
FT                   IYRENDNAALQIPSDVDGLIVVGRVSEGEIARLREVTGSLTFVDYPADSRQYDAVVIDF
FT                   AEAMEVVLAELTGLGHRSIGFIGGHRHFPPDEIVRDEREHAFRYYLDRRGLLDEALIYT
FT                   GDFNTSEGYRLMTEALQAQNRPTAFFIASDSMAIGAYRAAFEAGVRIPEDLSVVGFNDI
FT                   SASSYLQPSLSTVKVYTEFMGETAVDLAIERIRTKREIPKKVVLPTEFIRRESLKERTQ
FT                   SSRNKT"
     atggcaacga tgaaagatat cgcagagaaa tccggctatt ccatcgcgac ggtgtcgcgg        60
     gttctgaatc aggacgcgtc actcgccgtg acggatgcga caaaagagaa aatttttcag       120
     gtggcacagt cgctcgggta taaaaccctc cgggacaaac ggagtgagaa ggaagcgcag       180
     gatccgtcgc gtctcacgat ggggcttgtc tattaccgga cggaagaaca ggaactgagt       240
     gatccgtatt tcctgtcgat ccgtcttggt gtcgagaata agtgcgcgag aatgggtgtg       300
     accctcgaaa aaatctaccg ggaaaatgac aatgcggcac tgcaaatccc gtcagacgta       360
     gacggtctga tcgtggtcgg gcgcgtcagc gaaggggaga ttgcgagact gagagaggtg       420
     accgggtcgc tgacattcgt cgactacccg gcagactcgc gtcaatatga cgccgtagtc       480
     atcgattttg cggaggcgat ggaagtcgtg cttgcggaac tgacggggct tgggcaccgc       540
     tccatcggct ttatcggtgg acaccgtcat ttcccgccgg atgaaatcgt ccgtgacgag       600
     cgggaacatg cctttcgcta ctatctcgac cgcagaggcc tgttggatga agcactgatt       660
     tacaccggtg atttcaatac gtcggaaggg tacaggctca tgacggaggc gcttcaggca       720
     caaaatcggc cgacggcctt tttcattgcc agcgactcca tggcgattgg ggcctaccgg       780
     gctgcctttg aagccggggt acggatccct gaggatctgt cggtggtcgg ctttaacgac       840
     atctccgcat cgagctatct tcagccttct ttatcgaccg tgaaggtgta tacggagttc       900
     atgggcgaga cggcagtgga ccttgcgatt gagaggatcc gcacgaagcg ggagattccg       960
     aagaaggtgg tcttgccgac ggagtttatc cgcagggaaa gcctgaagga acgaacgcag      1020
     tcatcaagaa ataagacttg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page