(data stored in ACNUC7421 zone)

EMBL: CP001791.PE405

CP001791.PE405       Location/Qualifiers
FT   CDS_pept        complement(440627..442846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0418"
FT                   /product="glycoside hydrolase clan GH-D"
FT                   /note="PFAM: glycoside hydrolase clan GH-D; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97957"
FT                   /db_xref="GOA:D6XXA0"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXA0"
FT                   /inference="protein motif:PFAM:PF02065"
FT                   /protein_id="ADH97957.1"
FT                   /translation="MIHVNEPALEFHLQNSEVSYLFSVMKNRQLAHLYFGKRIHHEADF
FT                   SHLFRTQARAGMACVYEGDLTFSLDVIRQEYPSYGTSDFREPAFLLEEPKGSRITDFVF
FT                   DSWERLPGKPAIQGLPHVYADHDSEAETLVITLKDPVLNARLRLFWTIYADRPVITRHA
FT                   EFINDSKDTYRLHRAMSMNLDLFDSDYEMVQLSGSWARERHQHTMPLRPGVQSISSTRG
FT                   TSSAQQNPFLALKRPDTNEHHGDVYGFNLVYSGNFLARAEVDQFDVTRVSMGINPFDFS
FT                   WKLEGGETFTTPEAVLVHVTDGLNGMSRAFHALYRERLARGTWRDRDRPVLINNWEATY
FT                   FDFDEEKLLTIAKSAKELGVELFVLDDGWFGKRNDDTTSLGDWHANTAKLPEGVKGIAE
FT                   KINALGLSFGLWFEPEMVNKDSDLYRNHPDWVIHVPGRAMSHGRNQFVLDCSRQDVVDY
FT                   LFRRMAAVLDSAPVDYVKWDMNRYMTEIGSAKLPADRQQELPHRYILGVYELYERLTSA
FT                   FPHILFESCASGGARFDPGMLYYAPQAWTSDNTDAVERLKIQYGTSLAYPLSSMGAHVS
FT                   AVPNHQVHRHTSLEMRGDVSLFGMFGYELDLSLFTDKEKAAIKEQISRYKQHRALIRTG
FT                   TFYRLKSPFGPDGNETAWMVVSADQTEALVGWYRELARPHPGFKRLHLQGLNEDVAYRI
FT                   NDRVIHGSQLMHAGLMLPDEASGSVPPTTEKTGDFVSYVFHLSAE"
     atgattcacg taaacgaacc ggcacttgaa ttccatttgc aaaacagcga ggtcagctac        60
     ctcttctccg tcatgaaaaa ccgccagctt gcccacctgt attttgggaa gcgcattcat       120
     cacgaagcgg atttcagcca tctgttccgc acccaggcac gggcaggcat ggcctgcgtc       180
     tatgaagggg acctgacctt ttccctcgat gtcatccgcc aggagtaccc atcctacggg       240
     acatcggatt tccgggaacc cgctttcctc cttgaagaac cgaaaggaag ccggatcacg       300
     gatttcgtct tcgattcctg ggaacggctt cccggcaaac cggccattca aggactcccg       360
     cacgtctatg ccgatcacga cagtgaagcc gaaaccctgg tcattacgct gaaagatccg       420
     gtcctgaacg caaggctccg actgttttgg accatctatg ccgaccggcc cgtcatcacc       480
     cgtcacgcgg agttcatcaa cgacagcaag gacacatatc gcctgcatcg ggcgatgagc       540
     atgaacctcg acctcttcga cagtgactat gaaatggtgc agctctcagg ttcctgggca       600
     agggagcgcc atcagcacac catgcccctg agaccaggcg tccagagcat ctcaagcacc       660
     cggggaacga gcagcgccca gcaaaatccg ttccttgcct taaagcgccc ggacacaaac       720
     gagcaccatg gcgacgtgta cgggtttaac ctcgtctaca gcggcaactt cctcgcccgg       780
     gcggaagtgg atcagtttga cgtgacccgc gtatccatgg ggatcaatcc cttcgacttc       840
     tcctggaaac ttgaaggcgg ggaaaccttc acgacaccgg aagccgtgct cgtgcacgta       900
     acagacggat taaacggcat gagccgcgcg tttcatgccc tttaccggga gcgcctcgca       960
     aggggaacat ggcgcgaccg cgaccgccct gtcctcatca acaattggga agcgacctac      1020
     ttcgatttcg atgaggagaa actcctgacg attgcgaaga gtgcgaaaga gcttggcgta      1080
     gagctctttg tcctcgacga cggctggttc ggcaaacgaa acgatgacac cacctctctc      1140
     ggcgactggc acgccaacac cgccaaactc cctgaaggcg tcaaaggcat agcggaaaaa      1200
     atcaacgcac tcggcctttc ctttgggctc tggtttgaac cggagatggt caataaagac      1260
     agcgatctgt accggaatca tccggattgg gtcatccacg tccccggcag ggccatgtca      1320
     cacggacgaa atcagttcgt attagactgt tcccgccagg acgtcgtcga ctacctcttc      1380
     cggcggatgg ctgccgttct cgacagcgca cccgtggact acgtcaaatg ggacatgaac      1440
     cgctacatga cggagatcgg ttctgcaaag cttccggccg accgccagca ggagctccct      1500
     caccggtata ttctcggggt ctatgaactc tatgaacgac tgacgtcagc gttcccgcac      1560
     atcctgtttg aatcgtgcgc aagcggcggg gcacggtttg accccggcat gctctattat      1620
     gcgccccagg cgtggacgag tgacaacacc gacgccgtgg agcgccttaa aattcagtac      1680
     ggcacctccc tggcctatcc gctcagctcc atgggcgcac acgtctctgc cgtgccgaat      1740
     catcaggttc accggcacac gagcctcgag atgcggggag acgtttcgct cttcgggatg      1800
     ttcggctacg aactcgacct gagcctcttt accgataagg agaaagcggc catcaaagag      1860
     cagatcagcc gctacaaaca gcaccgcgca ctgattcgta ccggcacttt ctacagactg      1920
     aagagcccct ttggaccgga cggcaacgaa accgcctgga tggtcgtctc cgccgatcag      1980
     accgaggcgc tcgtcggctg gtaccgggag ctcgcccgtc ctcacccggg cttcaaacgc      2040
     ctgcatctcc aggggctgaa cgaggacgtc gcctaccgga tcaatgaccg ggtcattcac      2100
     ggcagccagc tcatgcacgc cgggctgatg cttccggacg aagcaagcgg ctccgttccg      2160
     ccgacaacgg agaaaacagg ggatttcgtc tcctacgtct tccacctctc agctgaatag      2220
//

If you have problems or comments...

PBIL Back to PBIL home page