(data stored in ACNUC7421 zone)

EMBL: CP001791.PE406

CP001791.PE406       Location/Qualifiers
FT   CDS_pept        443096..444262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0419"
FT                   /product="galactokinase"
FT                   /EC_number="2.7.1.6"
FT                   /note="TIGRFAM: galactokinase; KEGG: sse:Ssed_4020
FT                   galactokinase; PFAM: Galactokinase galactose-binding
FT                   domain; GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97958"
FT                   /db_xref="GOA:D6XXA1"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022963"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXA1"
FT                   /inference="protein motif:TFAM:TIGR00131"
FT                   /protein_id="ADH97958.1"
FT                   /translation="MIDHLKQEFDKIFHESGELRYFFAPGRVNLIGEHIDYNGGYVFPT
FT                   ALDVGTYLAVRKRSDRKLRFYSENFPQMGIVEGDLDDLAYSQADDWVSYAKGVLYMFME
FT                   EGMTGDKGFDVYVFGNIPNGAGLSSSASIELAFAVMWDAVNGFSMDRVTMVKLCQRAEN
FT                   EYIGVNCGIMDQFAIGFGKKEHAVLLDCDTLDYEYARLKLDGYKILIANTNKRRGLADS
FT                   KYNERRQECETALSELQEKEVVSHLCELDEAAFNEASHLIKGADRLKRARHAVTENERT
FT                   KKAFRALEDGDLPAFGQLMNDSHVSLRDDYEVTGKELDAMVEAAWQEETVIGARMTGAG
FT                   FGGCTVNIVKEDGLDETVKRISQRYTDQTGIEPKFYVVTTGDGAKELT"
     atgattgatc acctgaaaca ggaatttgat aaaatctttc atgaaagcgg agagctgcgc        60
     tatttctttg caccggggag ggtaaacctc atcggtgagc atattgacta taacggcggc       120
     tatgtgtttc cgacggccct tgatgtgggg acgtatctcg ccgtgaggaa gcggagtgac       180
     cggaagctgc gtttttattc ggagaatttc ccgcaaatgg ggattgtgga aggggatctc       240
     gatgatctgg catacagtca ggctgatgat tgggtcagct atgcgaaggg tgtcctttac       300
     atgtttatgg aagaaggcat gaccggagac aagggctttg acgtttacgt attcggcaat       360
     atcccgaacg gtgcgggtct gtcgtcttct gcgtccattg aactggcgtt tgcggtgatg       420
     tgggatgcgg taaacggctt ctcgatggac cgggtgacga tggtcaagct ctgtcagcgt       480
     gccgagaacg agtacatcgg cgtcaactgc ggcatcatgg accagttcgc catcggcttc       540
     ggcaaaaaag aacatgcggt gctcctcgat tgtgatacat tggactatga gtacgcacgt       600
     ctgaagttgg acggatacaa gatcctcatt gccaatacga ataagcggcg aggattggcc       660
     gattcgaagt acaatgagcg ccggcaggaa tgtgaaacag ccctctctga gctgcaggaa       720
     aaagaggtcg tgagccatct ttgtgaactc gatgaggcgg cctttaacga agcgagtcac       780
     ctgattaaag gggcggatcg tctgaagcgg gcgaggcacg cggtaacgga gaatgaacgg       840
     acgaaaaagg cgtttcgtgc ccttgaggat ggggacctgc ctgccttcgg ccagctgatg       900
     aacgactcgc atgtctcact ccgggatgat tatgaagtga ccggcaagga gctcgatgcc       960
     atggtggaag cagcctggca agaagagacg gtgatcggag caaggatgac cggggccgga      1020
     tttgggggct gtacggtgaa catcgtcaaa gaggacggtc tcgatgaaac cgtcaaacgg      1080
     atcagtcagc gctataccga tcagacaggc attgaaccga aattttacgt ggtgacaacc      1140
     ggagacggtg cgaaggaact gacgtaa                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page