(data stored in ACNUC7421 zone)

EMBL: CP001791.PE407

CP001791.PE407       Location/Qualifiers
FT   CDS_pept        444291..445292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0420"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="KEGG: dds:Ddes_1950 UDP-glucose 4-epimerase;
FT                   TIGRFAM: UDP-glucose 4-epimerase; PFAM: NAD-dependent
FT                   epimerase/dehydratase; Male sterility domain; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; short-chain
FT                   dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97959"
FT                   /db_xref="GOA:D6XXA2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXA2"
FT                   /inference="protein motif:TFAM:TIGR01179"
FT                   /protein_id="ADH97959.1"
FT                   /translation="MAVLVCGGAGYIGSHAVADLLASGEQVVVVDNLQTGHRGAVDDGA
FT                   VFYQADLRDEEALERVFNSHNIESVMHFAADSLVGVSMNEPLAYYDNNVYGALCLLKKM
FT                   KKHGVKRIVFSSTAATYGEPDEVPITEEMATNPTNPYGETKLAIERMMKWADEAHEIRY
FT                   VVLRYFNVAGAHPEKDIGEDHRPETHLIPIILQVALGQREKIMVFGDDYDTPDGTCIRD
FT                   YIHVTDLIQAHILALRYLRKGGTSDVFNLGNGSGFSVQEVIDTVETVTGKTIPRELAPR
FT                   RAGDPAQLIASSGKAKQVLGWAPERADLATIIATAWDWHQRHPDGYGEGSEA"
     atggcagtac tggtttgcgg aggagcgggt tacattggca gtcatgccgt ggccgatctt        60
     ctcgcttcag gtgaacaggt tgtggtggtg gataatctcc agacgggtca ccggggagcg       120
     gtcgatgatg gcgcggtatt ttatcaggcg gatcttcggg atgaggaggc cctggagcgg       180
     gtgttcaact cacacaatat cgaatctgtc atgcattttg cagcggattc gctggtcggc       240
     gtcagtatga atgagcccct tgcctattat gacaacaatg tttacggggc actctgcctc       300
     ttaaagaaga tgaagaaaca cggtgtgaag cggatcgtct tttcgtccac ggcagcaact       360
     tacggcgagc cggatgaagt gccgatcacg gaagagatgg cgaccaaccc gaccaatcct       420
     tacggggaaa cgaagcttgc cattgagcgg atgatgaagt gggcggatga agcccatgag       480
     atccgttacg tcgtcctccg gtatttcaac gttgccggcg cgcatccgga gaaggacatc       540
     ggggaagatc accggccgga aacccatctg attccgatca ttttgcaggt ggcgctcggg       600
     cagcgggaga aaatcatggt cttcggtgat gattatgaca cgccggacgg gacgtgcatc       660
     cgcgactata tccatgtgac ggacctcatc caggcacata tactggcgct ccgttatttg       720
     cgtaaaggcg gcacctcaga cgtctttaac ctcggcaacg gcagcggctt cagcgttcag       780
     gaagtcatcg ataccgtcga gaccgtcacg ggcaaaacaa ttccgcggga actcgcaccg       840
     cgccgtgccg gtgatccggc gcagctgatc gcgtcttcgg gtaaagcgaa acaggtcctc       900
     ggctgggcgc cggaacgggc ggatttggcg acgattattg ctaccgcctg ggactggcac       960
     cagcgccatc ctgacggtta cggggaaggg agcgaagcgt ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page