(data stored in ACNUC7421 zone)

EMBL: CP001791.PE409

CP001791.PE409       Location/Qualifiers
FT   CDS_pept        446944..447594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97961"
FT                   /db_xref="GOA:D6XXA4"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXA4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97961.1"
FT                   /translation="MLNLALILFGSGVYSLAEALKINMQRGVYEKHGRMARLIIALMTT
FT                   VVAVWTLGAPLFVQILIVIMLFAIAGEWLLPWRNGTFLLRNARPEDDLTALEALLEERR
FT                   ICYERSLNEDRHLVLLFPAYPKTKMVVKEKDSFVNDVYPTRTELTVRIRGMGNPLRETV
FT                   DDYLIDRREAREAGGFTKTALLYLVLAVIAVLAGVAMFYAAWQSPHEIPNMQR"
     gtgttgaatc tggcgttaat cctgtttggt tcaggggtgt acagcctggc agaggcgctg        60
     aagatcaata tgcaacgcgg cgtctatgaa aagcacggac gtatggcccg gctgatcatt       120
     gcccttatga ccactgttgt cgctgtctgg acactcggtg cgccgctttt tgtgcaaatc       180
     ctgattgtga ttatgctgtt tgcaattgcg ggtgaatggc ttcttccctg gcgtaacggg       240
     acgtttcttc ttcggaacgc ccgcccggaa gacgatctga cagcccttga agccttattg       300
     gaagagcggc ggatttgcta tgagcggagc ttgaatgaag accgtcacct ggtgctgctg       360
     tttccggcgt atccgaagac gaaaatggtg gtgaaagaaa aagactcctt tgtaaatgac       420
     gtctatccga cacgtacgga gctgacggtc aggatcaggg gaatggggaa tccgctcagg       480
     gagaccgttg acgactatct gatcgaccgc cgtgaagcga gggaagcggg gggattcacg       540
     aaaaccgccc ttttgtatct cgtcctcgca gtgatcgcag tattggcggg tgtggcgatg       600
     ttctatgcag cctggcagtc cccgcatgaa ataccgaata tgcaacgatg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page