(data stored in ACNUC7421 zone)

EMBL: CP001791.PE416

CP001791.PE416       Location/Qualifiers
FT   CDS_pept        complement(456118..456318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tmz:Tmz1t_1015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97968"
FT                   /db_xref="GOA:D6XXB1"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXB1"
FT                   /inference="similar to AA sequence:KEGG:Tmz1t_1015"
FT                   /protein_id="ADH97968.1"
FT                   /translation="MKANIGSTDRAIRIVIGITLLSLYFFLEGGARWIGLVGFVPILTS
FT                   FISFCPLYTLIGVNTCKVNTQ"
     atgaaagcga atatcggctc tacagaccgg gctatccgga tcgtcatcgg cattacgctc        60
     ttatcgttgt atttcttttt ggaaggcggc gcaagatgga tcgggctcgt cggattcgtc       120
     ccgattttga cctcattcat cagcttctgt ccgctctaca ccctgatcgg ggtcaacacg       180
     tgcaaggtta atacccaata a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page