(data stored in ACNUC7421 zone)

EMBL: CP001791.PE417

CP001791.PE417       Location/Qualifiers
FT   CDS_pept        456494..457408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0431"
FT                   /product="HtpX domain protein"
FT                   /note="PFAM: HtpX domain protein; peptidase M48 Ste24p;
FT                   KEGG: bba:Bd1287 heat shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97969"
FT                   /db_xref="GOA:D6XXB2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXB2"
FT                   /inference="protein motif:PFAM:PF06509"
FT                   /protein_id="ADH97969.1"
FT                   /translation="MGKRFFFFLLTNIMVMVTILIVWSLITEFTDLGRTFDTGGPGLGI
FT                   DLVSLAVFSILIGFMGSFISLAMSRFVAKKMMKVKVIDPDGPMSQEERIVVEKVHRLSR
FT                   AAGLMHMPEVGIYQSQEVNAFATGPSKKKSLVAVSSGLLHVMDDDAVEGVIAHEVAHVA
FT                   NGDMVTMTLLQGVINTFVVFFSRIIAIVASRLVPEQYQFIVQLASIIIFQILLSILGSI
FT                   VVMAYSRYREFHADRGGADLAGKDKMAHALRSLQSYVDRASVNRGRDDSAVQTMKISGK
FT                   RGMSLMFSSHPDLGERIARLEGK"
     atggggaaac gatttttctt ttttcttttg acaaacatta tggtcatggt taccattctc        60
     atcgtgtgga gcctgatcac ggaatttacc gatctcggaa gaacgtttga caccggtggt       120
     cccgggcttg gcattgacct tgtctcactg gctgtcttca gtattctgat cgggttcatg       180
     ggcagtttca tctctcttgc gatgtcacgt tttgtcgcca agaagatgat gaaggtcaag       240
     gtcattgacc cggatggccc gatgagtcag gaagagcgga ttgtggtgga gaaggttcac       300
     cgtctttcaa gggctgccgg tctcatgcac atgccggaag tcggcattta tcagtcgcag       360
     gaagtgaacg cgtttgcgac gggtccttcg aagaagaagt cactggttgc tgtctcgtca       420
     gggctattac atgtcatgga tgatgacgcc gtagaagggg ttattgccca tgaagtggcg       480
     cacgtggcca acggtgatat ggtgacgatg acgctcttgc agggtgtgat caacaccttc       540
     gttgtgttct tctcacgcat cattgccatc gtggcatcgc gtctcgtacc ggagcagtac       600
     cagtttattg tccagctggc atcgatcatt atcttccaga tcctcttgtc gatcctcgga       660
     agcatcgtcg tcatggccta ctcgagatac cgtgaattcc acgcggatcg cggtggcgcc       720
     gatcttgccg gcaaagacaa aatggcacac gcactcaggt ccctgcaaag ctatgtggac       780
     cgtgccagtg tgaaccgagg acgtgatgat tctgccgtac agacgatgaa gatcagcggc       840
     aagcgcggta tgtctctcat gttctcctca cacccggatc tcggtgaacg cattgcccgc       900
     cttgaaggga aataa                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page