(data stored in ACNUC7421 zone)

EMBL: CP001791.PE418

CP001791.PE418       Location/Qualifiers
FT   CDS_pept        457564..459603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0432"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; extracellular solute-binding
FT                   protein family 3; PAS fold-4 domain protein; PAS fold
FT                   domain protein; histidine kinase A domain protein; KEGG:
FT                   dde:Dde_1684 PAS/PAC sensor signal transduction histidine
FT                   kinase; SMART: ATP-binding region ATPase domain protein;
FT                   extracellular solute-binding protein family 3; histidine
FT                   kinase A domain protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97970"
FT                   /db_xref="GOA:D6XXB3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXB3"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADH97970.1"
FT                   /translation="MRVTGLLAMMVLVLSVWLTEPAQAEVNRHGESPALRVAFDPELIP
FT                   FHDRSNGEQGFSLALMEQIAEGMEREADYVEMSQARAVEAIQNQEVDIILTIPFSEQFS
FT                   TRMEFTDSIFSTSIGMVTRVHDDEISVITDLSESLVAIQQQTIEYEFLRNIRRIQFQVT
FT                   TDQRRAFELFLDGRADTFVGNMTTTGALIERLGMEEDVNVADSFLMPVDYSIAVQRENY
FT                   TLLNAVNTEIRRMRASGAYGELYEQYFQEEGADGWLLMTVQAAAGVIVIFTIVLFLGIR
FT                   WNRQLQYEVSKKTGDLNQLNESLLEQIELKRDNNEFLNQILDSSPRGIVTLDSNGRITK
FT                   FNPKANLLTGLSEAPLQRDYRDVSLLNRLLEGKAVEILAGEERRYLGEYQTWTRDDGEK
FT                   FQFRYFVYPLFNYSREVAGLILTFEDVTSEMELRNKVFEQEKNQALSRVVAGIAHEIRN
FT                   PLSSIKTFVELIPRKINNQKFQEEIATYVPKEIVRVSELIEGLINYARPRHQEPEAVDA
FT                   GILMHESFILFERTGKNKGMTLELNQEEGLWIEVDPQQVKQAVINLIINGLDAMEARKN
FT                   TEGGGTMTLTLAVFEQDGCVHLSVTDEGIGMADDELAKVLEPFYTTKDKGSGLGLAISS
FT                   QLVKDNGGELLIVSEKGTGTTMTLVFPKKPDQTDPQARKGGRRS"
     atgagggtga cagggttgct tgccatgatg gtgctcgtgc tgtccgtatg gctgacggaa        60
     ccggctcagg cggaagtgaa ccgccacggg gaatcccccg cgcttcgggt tgcttttgac       120
     ccggaactga tcccctttca cgaccggtcg aacggagaac agggtttttc ccttgcgctc       180
     atggagcaga tcgcagaagg gatggagcgt gaggcggact acgtggagat gagccaggca       240
     agggcggtgg aggccatcca aaatcaggag gtggatatca tcctgacgat tccgttctcc       300
     gaacagtttt cgacccggat ggaattcacg gattcgattt tttccacatc catcgggatg       360
     gtgacccggg tccatgacga tgagatcagc gtcattacgg atctttccga gtccctcgtc       420
     gcgattcagc aacagaccat cgagtatgaa tttctccgta atatccggcg tatccagttc       480
     caggtgacga cagatcagcg gcgggccttt gagctctttc tcgacgggcg tgcagacaca       540
     ttcgtcggca atatgacaac aacgggggct ctgatcgaac gccttggcat ggaagaagac       600
     gtgaatgtgg cggattcgtt tttgatgccg gtggattatt ctattgcggt tcagcgggag       660
     aactataccc tgttaaatgc ggtcaatacg gagatccgcc gcatgcgggc atccggtgcc       720
     tacggggaac tgtatgaaca gtattttcag gaggagggag cggacggctg gctgttaatg       780
     acggtgcagg ctgcggccgg ggtgatcgtc atctttacga ttgtcctctt tctcgggatc       840
     cgctggaacc gccagctcca atacgaagtg tcgaagaaga cgggggatct gaatcagctg       900
     aacgaatccc tccttgaaca gatcgaactg aagcgtgaca ataatgaatt cctgaatcag       960
     atcctcgaca gcagtccaag ggggatcgtg accctcgaca gcaatggccg gatcacgaag      1020
     tttaacccga aggccaattt gctgacaggg ctcagcgagg cgcctcttca gcgtgattac      1080
     cgggatgtgt cgctgttgaa ccggctgctt gaagggaaag ccgtggagat cctcgccggc      1140
     gaagagcggc gttacctcgg ggagtaccag acgtggaccc gcgatgacgg tgagaagttt      1200
     cagttccggt atttcgtcta tccgctgttt aactacagcc gggaagtggc gggtctgatt      1260
     ctgacatttg aggatgtgac gtcggagatg gagcttcgaa acaaggtgtt tgagcaggag      1320
     aagaaccagg cgctcagccg cgtcgttgca gggattgccc atgagatccg caacccgctc      1380
     agctcgatca aaaccttcgt cgaactgatc ccgcggaaga tcaataatca gaagtttcag      1440
     gaagagatcg ccacatacgt cccgaaggaa atcgtccggg tcagtgaact gatcgaaggc      1500
     ctgatcaatt acgcaaggcc gaggcatcag gagccggaag cggtggatgc gggcatactg      1560
     atgcatgagt ccttcattct gtttgagcgg acgggtaaga ataaggggat gacccttgaa      1620
     ctcaatcagg aagaggggct gtggattgaa gtcgatccgc aacaggtcaa gcaggcggtg      1680
     ataaacctca tcatcaacgg acttgatgcg atggaagcga gaaaaaacac ggagggcgga      1740
     ggaacgatga cgctgacgct tgccgtcttt gaacaggacg ggtgcgtgca tctctccgtc      1800
     acggacgaag gcattggtat ggcggatgac gaactggcca aggtgctcga gccgttttac      1860
     acgacgaagg ataaggggtc gggcctcgga ctggccattt cgagtcagct tgtcaaagat      1920
     aacggcggtg agctattgat cgtcagtgag aaaggaacgg ggacgacgat gacgcttgtc      1980
     ttcccgaaga aaccggacca gacggatccg caggcgcgta aagggggcag gagatcatga      2040
//

If you have problems or comments...

PBIL Back to PBIL home page