(data stored in ACNUC7421 zone)

EMBL: CP001791.PE419

CP001791.PE419       Location/Qualifiers
FT   CDS_pept        459600..460961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0433"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: dal:Dalk_0661 two component, sigma54 specific,
FT                   transcriptional regulator, Fis family; PFAM: sigma-54
FT                   factor interaction domain-containing protein;
FT                   helix-turn-helix Fis-type; response regulator receiver;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: response regulator receiver; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97971"
FT                   /db_xref="GOA:D6XXB4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXB4"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADH97971.1"
FT                   /translation="MTKIIIIDDEEGICSSLVFALEDDYDTEAFTNPAEGLKSVIADQP
FT                   AVVLLDLKIGSVNGIDVLKEIRKQAPGTEVIMITAYGTISSSVEALQNGAYSYVTKPLN
FT                   MDELFANISRVMEYKALNRQVQALSDQLERKYRYEEMVGKSDAMQKLYRLIDKVKEVDT
FT                   NVLITGESGTGKELVARAIHYAGKRRSGPLEVVNCAAIPETLLESELFGYEKGAFTGAT
FT                   QRKAGKFELAHGGTLFLDEIGDMPVQLQAKLLRVLQKREVTRLGGTEAKLFDVRVIAAT
FT                   NVSLEKETEEGHFREDLYFRLNVIQLQLPPLRERTADLPILLKHFIDKYNREMNKSIQG
FT                   FSKEAEQRIFNHHFPGNIRELANIIESSMVITDGEIIEPEDLPAYLNRGTKRQESEEAS
FT                   LKPFVRLGYTLKALEKAFILETLEAENGHRKHTATKLGISERSLRDKIKQYEQG"
     atgacgaaaa ttatcattat tgacgatgaa gaagggatct gttcatcgct cgtatttgca        60
     cttgaggatg actatgacac cgaagccttc acgaaccccg cagagggact gaagtcggtc       120
     attgccgatc agccggctgt cgtgcttctt gatttgaaga tcggcagtgt gaacgggatc       180
     gatgtcctca aagaaatccg aaaacaggcg ccgggtacgg aagtgattat gattacggct       240
     tacggcacga tctcgtcttc cgtggaagca cttcagaacg gggcatacag ctatgtgacg       300
     aagccactca atatggatga gctctttgcg aatatcagcc gggttatgga atacaaggct       360
     ctgaaccggc aggtccaggc gctgtctgat cagctcgagc ggaaataccg ctacgaagag       420
     atggtcggca agagtgatgc gatgcagaaa ctgtaccgcc tgattgacaa ggtgaaggaa       480
     gtggatacga acgtgctgat cacgggcgag agcggtaccg ggaaggagct cgtggcaagg       540
     gcgatccatt acgccgggaa gcggcgaagc ggccctttgg aagtggtgaa ctgcgcggct       600
     attccggaaa cgctccttga aagcgagttg ttcgggtatg agaaaggagc ctttaccggt       660
     gccacacagc gaaaagcggg gaagtttgaa cttgctcacg gcgggacgct gttccttgat       720
     gaaatcgggg atatgccggt tcagcttcag gcgaaactcc tccgggttct gcaaaagcgt       780
     gaggtgacac gtcttggcgg aacggaagcc aagctgttcg atgtccgggt catcgccgcg       840
     acgaacgtgt ccctcgagaa agaaacggaa gaagggcatt tcagggagga tctgtatttc       900
     cggctgaacg tgattcagct gcagcttccc cctcttcggg agcggacggc ggacttgccg       960
     attcttctca aacattttat cgataaatac aacagggaaa tgaacaagag tattcagggg      1020
     ttctctaaag aagcggaaca gcggatcttc aatcatcatt tccccgggaa catccgtgaa      1080
     cttgcaaata tcattgaatc ttcgatggtg attaccgatg gggagatcat cgagcctgag      1140
     gatctacctg catatctgaa ccggggtacg aagcgtcagg agtcggagga agcgtcactg      1200
     aaaccgttcg tccggctcgg atataccctg aaggcccttg agaaggcgtt cattcttgaa      1260
     accctggagg cggaaaacgg acaccgcaag cacacggcaa cgaaactcgg gatcagtgaa      1320
     cggagcctgc gggataaaat caagcaatat gaacagggtt ga                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page