(data stored in ACNUC7421 zone)

EMBL: CP001791.PE42

CP001791.PE42        Location/Qualifiers
FT   CDS_pept        51640..53628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0043"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="KEGG: gsu:GSU2232 methionyl-tRNA synthetase;
FT                   TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: tRNA synthetase class I
FT                   (M); t-RNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97594"
FT                   /db_xref="GOA:D6XV36"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV36"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ADH97594.1"
FT                   /translation="MSNEKNTFYITTPIYYPSAKLHIGHAYTTVAGDAMARYKRLRGFD
FT                   VRYLTGTDEHGQKIEQKAEENGKSPQQFVDDISSDIQELWKKLDISYDDFIRTTEDRHK
FT                   QVVQHIFERFLEQGDIYLDEYEGWYSVSDETFYTELQLEDKEYDDNGNVTGGKSPDSGH
FT                   PVEKVREKSYFFKMSKYADRLLAYYEDNPEFIQPESRKNEMINNFIKPGLEDLAVSRTS
FT                   FRWGVPVKSDPEHVVYVWIDALSNYITALGYSTDENGLFQSHWPADVHLVGKEIVRFHT
FT                   IYWPIMLMALDLPLPKKVFGHGWLLMKDGKMSKSKGNVVDPVPLIERYGLDALRYYLLR
FT                   EVPFGSDGVFTPEGFVERVNYDLANDLGNLLNRSVAMINKYFDGEVPAYVKDATSYDET
FT                   LTDLVEATVNKVEESMENMQFSVALTAIGQLISRTNKYIDETQPWILAKDETAREQLGS
FT                   VLHHLVESLRQVSIMLQPFMTETPKKIQEQLSIPDSLMGWDTLVTFGQIPAGKKVVAKG
FT                   EPIFPRLDTEEEVKAIVEMMGGQVKTEEPEPEVEAPEVDEITIDDFTKVDLRVAEVLEA
FT                   EKVKKADKLLKVQLDLGYEKRQVVAGIAKHYSPEDIIGKKVICVSNLKPVKLRGELSQG
FT                   MILAGSHGDTLTLATVSDHLPNGSQVK"
     atgagtaatg agaagaacac cttttacatc accacaccga tttactaccc gagtgcaaag        60
     ctgcacatcg gtcacgccta cacgacggtg gccggtgacg ccatggcccg ctacaagcgg       120
     ctcagaggct ttgatgtgcg ttacctgaca gggacagacg agcacgggca gaagattgag       180
     cagaaagcag aagagaacgg gaagtccccc cagcagtttg tcgatgatat ttcgtcggat       240
     attcaggagc tgtggaagaa gctcgatatc tcctacgatg attttatccg cacgacagaa       300
     gaccggcata aacaggtcgt gcagcacatc tttgaacggt ttctcgagca gggtgatatc       360
     tacctcgatg aatacgaagg ctggtattcc gtatctgatg aaaccttcta taccgagctg       420
     cagcttgaag acaaggaata tgacgacaac ggcaacgtaa ccggcggcaa gagcccggac       480
     agcgggcacc ctgttgaaaa ggttcgggag aagtcgtact ttttcaagat gagtaagtat       540
     gccgaccgac ttttggccta ttatgaggat aatcccgagt tcattcagcc ggaatcacgg       600
     aagaatgaga tgatcaacaa ctttatcaag ccgggtcttg aagatctcgc cgtatcccgg       660
     acgtcatttc gctggggggt gccggtgaag agtgatccgg aacacgtcgt ctatgtctgg       720
     attgatgcgt tgtcgaacta catcacggcc cttggctaca gtaccgatga aaacggcctg       780
     tttcagtccc actggccggc ggatgtgcat ttggtcggca aggagatcgt ccgcttccat       840
     accatttact ggccgattat gctgatggcc cttgatctgc cattgccgaa aaaagtgttc       900
     ggtcacggct ggctcttaat gaaagacggc aagatgtcga aatccaaagg gaacgtcgtc       960
     gatccggttc cgctcattga acgctacggc ctcgacgcgc tccgctacta tctgctccgg      1020
     gaagtgccgt ttggttcaga cggggttttc acccctgaag gattcgtcga gcgggtgaac      1080
     tatgatttgg ccaacgacct ggggaattta ctgaaccgaa gcgtggctat gatcaacaaa      1140
     tattttgacg gcgaggttcc ggcctacgtc aaggatgcaa cctcgtatga tgagaccctg      1200
     acggatctcg ttgaagcgac ggtgaacaag gttgaagaat ccatggagaa catgcagttt      1260
     tccgtggctt tgacggccat cggccaactc atcagccgca cgaacaagta tattgatgaa      1320
     acacagccgt ggatccttgc caaagatgag acggcgagag aacagctcgg ttctgtcctg      1380
     catcatctgg tggagtcgct tcggcaggtg tcgattatgc ttcagccgtt tatgacggaa      1440
     acaccgaaaa agattcagga acagctcagt attcccgaca gcctgatggg ctgggacacg      1500
     ctcgtcacat ttggtcagat cccggcagga aagaaggtcg tcgccaaagg agaaccgatc      1560
     ttcccgcgtc ttgatacgga agaagaagtg aaggccatcg tcgaaatgat gggcggacag      1620
     gtgaaaaccg aagaaccgga gccggaggtg gaggcaccgg aggtcgatga gattaccatt      1680
     gatgatttca caaaagtcga tctgcgcgtc gcagaggtac tcgaagcgga gaaggtaaaa      1740
     aaggcggaca aacttctgaa ggtccagctt gatctcggct atgagaagcg tcaggtggtc      1800
     gcaggcattg ccaaacacta cagcccggaa gacatcatcg ggaaaaaagt gatctgtgtc      1860
     tccaatctga agccggtcaa gctccggggc gagctgtcac agggcatgat cctcgccgga      1920
     tcgcacggtg atacgctgac gctcgcgacg gtctccgatc atctgccgaa tggttctcag      1980
     gtgaaataa                                                              1989
//

If you have problems or comments...

PBIL Back to PBIL home page