(data stored in ACNUC7421 zone)

EMBL: CP001791.PE420

CP001791.PE420       Location/Qualifiers
FT   CDS_pept        461157..462191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0434"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: par:Psyc_0746 TRAP-T family transporter
FT                   periplasmic substrate binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97972"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXB5"
FT                   /inference="protein motif:TFAM:TIGR02122"
FT                   /protein_id="ADH97972.1"
FT                   /translation="MKKAMLSAMGLLLIGTAAACGNDNEAADAGNNDGGADNNGNTEAN
FT                   AGGADMDDLFITVATGGTSGVYYPIGGAISNILDQDLGVDTSVQSTGASVENVNLIDSN
FT                   RAELAITMADAVAQAYEGSGAFDGEEPIESLRGLTALYPNFVQVVTTADTGIESIYDLE
FT                   GRDVGVGAPGSGVELNARMILDAHGMDYDDINEDFLSYSEAIDQIKNGMVDAAFVTSGV
FT                   PNATIIDLSTTHDAVVLPIEGEPMDNLMDEYAFFSTGVIPGGTYDQEEDVNTATITNVL
FT                   LVNSELSDDVVYEITRSLFEHIDDLHASHNAATDISLDSVMEGMPVPLHPGAERYFEEQ
FT                   GVLD"
     atgaagaaag caatgttgag tgcgatgggg ttactgttga ttggaacggc agcggcttgc        60
     ggcaatgata acgaggcggc ggatgccggc aacaacgatg gcggagcgga caataacggt       120
     aacactgagg ccaacgccgg cggagcggat atggacgatc tgttcattac cgtggcaaca       180
     ggcggaacaa gcggggtgta ctatccgatc ggcggggcga tttcgaacat tctcgatcag       240
     gacctcgggg tggatacctc cgttcagtcc acaggggctt ctgttgagaa cgtcaacctg       300
     attgactcca atcgtgccga actggccatt acaatggcgg acgccgtggc tcaggcgtat       360
     gaaggcagcg gtgctttcga tggcgaagag ccgattgaat cactgagagg gctcactgca       420
     ctgtacccga actttgtcca ggtcgtcacg acagccgaca cgggcattga atcgatctat       480
     gaccttgaag gacgggacgt cggggtcggg gcaccaggct ccggggtgga actgaatgcc       540
     cggatgattc tcgatgcgca cggtatggac tatgatgata tcaatgaaga cttcctgtcc       600
     tacagtgaag cgattgatca gatcaaaaac ggcatggtcg atgcggcatt tgtgacgagc       660
     ggggtaccga atgcaacgat tatcgacttg tccaccacgc atgatgccgt cgtacttccg       720
     attgaaggcg aaccgatgga taatctgatg gacgagtacg cgttcttctc caccggtgtc       780
     attcccggcg gtacgtacga tcaggaagaa gacgtgaata cggcaacgat tacgaacgta       840
     cttctcgtga acagtgaact gagtgacgat gtggtgtatg agattacccg gtcgctcttt       900
     gagcatatcg atgacctgca cgcatcgcac aacgcggcca cggatatttc tctcgacagc       960
     gtgatggaag ggatgccggt gcctctgcat ccgggagcgg agcgttactt tgaagaacag      1020
     ggtgtgctgg actaa                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page