(data stored in ACNUC7421 zone)

EMBL: CP001791.PE421

CP001791.PE421       Location/Qualifiers
FT   CDS_pept        462246..462722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0435"
FT                   /product="Domain of unknown function DUF1850"
FT                   /note="PFAM: Domain of unknown function DUF1850; KEGG:
FT                   csa:Csal_0387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97973"
FT                   /db_xref="InterPro:IPR015001"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXB6"
FT                   /inference="protein motif:PFAM:PF08905"
FT                   /protein_id="ADH97973.1"
FT                   /translation="MKRLMGLLIIMVMGTGLYYTSANETGEVMVVLESEREGQVFFERP
FT                   VSAGDIYELSWIHSVEKTPWAERYAVTDGDAFLLERTEFASYGAGVPHEANEVRTENGM
FT                   IIYDGINTLHDDLRWIHSHQAEHALYINGEQAFPPSAIPHQTAVRLYIEWRSSE"
     atgaaacgac ttatgggtct gctgattatc atggtgatgg gaacggggct ttactatacg        60
     tccgcaaatg agaccggtga agtgatggtt gttcttgaaa gcgagcggga aggacaggtc       120
     ttttttgaaa ggccggtatc cgccggggat atctatgaac tgagctggat tcattctgtg       180
     gagaagacac cctgggccga gcggtacgct gtaaccgacg gggatgcatt cctcctcgaa       240
     cggactgaat ttgcctccta cggcgcaggt gttcctcatg aagcgaatga ggtacgaacg       300
     gaaaacggca tgatcattta cgatggcatc aatacgttgc atgatgattt gcgttggatc       360
     cattcgcatc aggcggagca tgccctctac atcaatggtg aacaggcatt ccccccgtca       420
     gccatcccgc atcagacagc agtcagactc tatattgaat ggaggtcatc cgaatga          477
//

If you have problems or comments...

PBIL Back to PBIL home page